DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33964 and Rrnad1

Sequence 1:NP_001033941.1 Gene:CG33964 FlyBaseID:FBgn0053964 Length:484 Species:Drosophila melanogaster
Sequence 2:XP_006232748.1 Gene:Rrnad1 RGDID:1311265 Length:498 Species:Rattus norvegicus

Alignment Length:505 Identity:133/506 (26%)
Similarity:220/506 (43%) Gaps:83/506 (16%)


  Fly     8 QLQRRLDGLLAFLNPHWDFVNCHMVNYLTDQHWDGFLSETLKSEIAGKEDVALAI---------E 63
            ||...|..:||.   :...::.:::.:.||..| |.|....:..:.|.....||.         |
  Rat    39 QLAVDLTRVLAL---YRSILDAYIIEFFTDSLW-GTLPHAWQEVLDGLNPPELATLLLGMPREGE 99

  Fly    64 DLFWKTDESERFPAWREFLGKSKQERLSL----HPKLLTSVEELIEGQGNSTQLS--IREFMSAK 122
            ::.:::       .|...|...|....:|    .|...|. .|.:|....|::|:  .|:.:..|
  Rat   100 EIRYRS-------VWPLTLLALKSTACALAFTRTPGFHTP-SEFLENPSQSSRLTAPFRKHVKPK 156

  Fly   123 KCHEVDLTAVLVDQLVKNSGQDCF-IVDAGDGKGYLSSRLALQYGHRVLGIDANAANTENALNRN 186
            |.||:.....||.:|...:|  |. :||.|.|:|:||..::|..|..|..::.|......|...:
  Rat   157 KQHEIRRLGELVKKLSDLTG--CTQVVDVGSGQGHLSRFMSLGLGLMVKSLEGNKRLVARAQRLD 219

  Fly   187 RKLQRAWNGLTERAELQVQGITPKRRSKKSPARESTKSAPALENYKTTAKFITTELNFGALLAEN 251
            ::|.:|.:.:.:|....||. :|:.|    |.......:|      ||   :..||    ||.  
  Rat   220 QELLQALDKMEKRHPKMVQR-SPRHR----PHHVVQWVSP------TT---LCEEL----LLP-- 264

  Fly   252 FTQFRPEDSPNICLTGLHTCGNLAATCLQVFHAQTDCRLLCNVGCCYHLLRERYSQQEFFGNKSL 316
             .:...:.|..:.|||||.||:|:...|:.|....:...|.:|||||                  
  Rat   265 -LEMPGQSSTRLLLTGLHACGDLSVALLRHFCCCPEVVALASVGCCY------------------ 310

  Fly   317 MELQTDYGFPLSQYL-----RERQVRMGRNARMLAAQSIERTLDTKELPNV-TLYYRALLEILVC 375
            |:|.....:||||::     .|...|:...|........||.  .|..|.: |..:||.||.::.
  Rat   311 MKLSDPGSYPLSQWVAGLPGHELPYRLREGACHALEDYAERL--QKAGPGLQTHCFRAALEAVIR 373

  Fly   376 RHAPELKNELQVGKVRKFE-SFEEYIQKCATKLDAPWLAAVEKEELQSLLQEYAVHKYFLDLFYL 439
            :..|||:.....|..|..| ..|||:|:...::.......::    |:.||.:...:..:..|:.
  Rat   374 QVCPELRRPGVQGIPRVHELKIEEYVQQGLQRVGLDPQLPLD----QAALQAHQAQENRVVAFFS 434

  Fly   440 LRMSFAPVLESLILLDRLLYLKELGYERSYLIDLFDPVISPRHFAIVSIK 489
            |.:..||::|:||||||:|||:|.|: .:.|:.:|.|.:|||:..:|:.|
  Rat   435 LALLLAPLVETLILLDRMLYLQEQGF-YAELLPIFSPELSPRNLVLVATK 483

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33964NP_001033941.1 Methyltransf_32 122..304 CDD:290402 53/183 (29%)
Rrnad1XP_006232748.1 Methyltransf_32 156..316 CDD:290402 55/201 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2651
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.