DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33964 and orc3

Sequence 1:NP_001033941.1 Gene:CG33964 FlyBaseID:FBgn0053964 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_997892.2 Gene:orc3 ZFINID:ZDB-GENE-030131-6247 Length:706 Species:Danio rerio

Alignment Length:479 Identity:90/480 (19%)
Similarity:163/480 (34%) Gaps:140/480 (29%)


  Fly    24 WDFVNC---HMVNYLTDQHWDGFLSETLKSEIAGKEDVALAIEDLFWKTDESERFPAWREFLGKS 85
            |:.|..   .:.|.|..:..|..:....|.|:....||        |:...|| .|.....||.:
Zfish    53 WETVQTSTEEIQNQLNKKVLDSLVEFIKKHELGSSSDV--------WRQRTSE-IPTAALMLGVN 108

  Fly    86 KQERLSLHPKLLTSVEELIEGQGNSTQLSIREFMSAKKCHEV-DLTAVLVDQLVKNSGQDCFIVD 149
            ..:    |.....|:..|::.......:|:.    ||:|..| .|...:::||:           
Zfish   109 VPD----HAMTFRSLCNLLQDSVTPFVVSVH----AKECAAVKHLIQKVLEQLM----------- 154

  Fly   150 AGDGKGYLSSRLALQYGHRVLGIDANAANTENALNRNRKLQRAWNGLTERAELQVQGI------T 208
               ||                .:..:....|:|            .|.::|:..:..:      .
Zfish   155 ---GK----------------AVSVDEEQEEDA------------ALPQKAQCTISALCQWYKTA 188

  Fly   209 PKRRSKKSPARESTKSAPALENYKTTAKFITTELNFGALLAENFTQFRPEDSPNICLTGL----- 268
            .|:.|:|.......:|.|.:..:|....|.:..|.....:...:.|    :.|.|.:.|:     
Zfish   189 TKKCSQKKNDNGLRQSLPVVVIFKDFEAFNSQVLQDFIHICSRYIQ----ELPFIFVFGIATSPS 249

  Fly   269 -------HTCGNLAATCLQVFHAQTDCRLLCNVGCCYHLLRERYSQQEFFGNKSLME---LQTDY 323
                   |:..:|  .|::||.         :|.|..||             .|:.:   |...:
Zfish   250 AIQHRLPHSVSSL--LCIEVFQ---------SVSCTQHL-------------ASVFDKLILNAHF 290

  Fly   324 GFPLSQYLRERQVRMGRNARMLAAQSIERTLDTKELPNVTLYYRALLEILVCRHAPEL-----KN 383
            .|.||.  |..||.:|  ..:....|::..:...:...:..:....|.:|.||....|     .:
Zfish   291 PFKLSS--RVIQVLVG--IFLYHDFSVQNFVKGLQFSMLEHFNSQPLSVLCCRKREALLCAKTLS 351

  Fly   384 ELQVGKVRKFESFEEYIQKCATKLDAPWLAAVE--KEELQSLLQEYAVHKYFLDLFYLLRMSFAP 446
            :..|.::|...||..|::....:.....|.:.:  ||..|:||:  ::|||..:.|        |
Zfish   352 QQNVERIRHLPSFMRYVETQEPEEQVKLLTSDQHVKEVCQTLLK--SLHKYHKNYF--------P 406

  Fly   447 VLESLILLDRLL-------YLKEL 463
            :|:.|..|...|       :::||
Zfish   407 ILQCLHSLTSSLPKFPLGKHIREL 430

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33964NP_001033941.1 Methyltransf_32 122..304 CDD:290402 33/201 (16%)
orc3NP_997892.2 ORC3_N 22..336 CDD:284456 64/374 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.