DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33964 and Mettl25

Sequence 1:NP_001033941.1 Gene:CG33964 FlyBaseID:FBgn0053964 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_001101559.1 Gene:Mettl25 RGDID:1310270 Length:600 Species:Rattus norvegicus

Alignment Length:605 Identity:173/606 (29%)
Similarity:266/606 (44%) Gaps:146/606 (24%)


  Fly     9 LQRRLDGLLAFLNPHWDFVNCHMVNYLTDQHWDGFLS-------ETLKSEIA----------GKE 56
            |...|..||:||.......:.|.|::.|...|...:.       .||:...|          |:.
  Rat    16 LHATLQDLLSFLRGALAISSAHTVDFYTKSIWQELVDLPPESVLATLRKSAAEAELHETLPLGEA 80

  Fly    57 DVALAIEDL---FWKTDESERFPAWREFLGKSKQ---ERLSL---HPKLLTSVEELIEGQGNSTQ 112
            :......||   |.:|  |::..:...|:..:|.   :.|.|   ..:|||::....| |.....
  Rat    81 EAGSGFIDLPKIFCET--SQKLLSVEAFVLTAKHYSVQNLGLCTPSEQLLTALRVNTE-QRTDEN 142

  Fly   113 LSIREFMSAKKCHEVDLTAVLVDQLVKNSGQDCFIVDAGDGKGYLSSRLALQYGHRVLGIDANAA 177
            :...|||:.||.|||...:.|:..:....|.. .|:|.|.|||||||.|:|:||..|.|||:::.
  Rat   143 VKAIEFMNTKKSHEVQAMSELICSIADYCGLK-QIIDVGSGKGYLSSFLSLKYGLNVYGIDSSST 206

  Fly   178 NTENALNRNRKLQRAWN------------------------------GLTERAELQVQG------ 206
            ||..|..|||||::.||                              |.:||.:...:|      
  Rat   207 NTHGAKERNRKLKKHWNLCHSQSRADSNGLVLKMPKESKVQSRSKCEGESERVQKSRRGDEDASA 271

  Fly   207 -------------ITPKRRSKKSPARESTK---------------------------SAPALEN- 230
                         |..::|:..:...|..|                           .||.|.. 
  Rat   272 GVLADFSGSPVSVIRKQQRNLHAHPVEEEKLCCEDAFSLVDFLPVDAIEPTSQVCHTEAPGLRKE 336

  Fly   231 -------------YKTTAKFITTELNFGALLAENFTQFRPEDSPNICLTGLHTCGNLAATCLQVF 282
                         |.....|||.:.....::         ||..:..:.||||||:||...|::|
  Rat   337 RGNATSKTRGSSIYSPLTSFITADTQLHDII---------EDLEDCLMVGLHTCGDLAPNTLRIF 392

  Fly   283 HAQTDCRLLCNVGCCYHLLRERYSQQEFFGNKSLMELQTDYGFPLSQYLRERQVRMGRNARMLAA 347
            .::.:.:.:|:||||||||.|.:..|    :|..  .:.::|||:..||:|.:...||||||.|.
  Rat   393 ASKAEVKGVCSVGCCYHLLSEEFENQ----HKGY--AKENWGFPMCHYLKEERWCCGRNARMSAC 451

  Fly   348 QSIERTLDTKELPNVTLYYRALLEILVCRHAPELKNELQVGKV-RKFESFEEYIQKCATK--LDA 409
            .::||.:..:.||..:|:|||:|:.::.......|.|..|||: .|..||.||::....|  ||.
  Rat   452 LALERVVVGQGLPTESLFYRAVLQNIIKDCYGISKCEQYVGKIYSKCSSFLEYVRVSLKKLGLDE 516

  Fly   410 PWLAAVEKEELQSLLQEYAVHKYFLDLFYLLRMSFAPVLESLILLDRLLYLKE---LGYERSYLI 471
            ..::|   |.:....::|......|:.|.:|::..||.:|:|||||||.||||   :.:  |.|:
  Rat   517 SKISA---EIIMDYYEKYKPRMNELEAFNMLKVVLAPCIETLILLDRLCYLKEQEDIAW--SALV 576

  Fly   472 DLFDPVISPRHFAIVSIKQQ 491
            .|||||.|||.:|::::|:|
  Rat   577 KLFDPVQSPRCYAVIALKKQ 596

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33964NP_001033941.1 Methyltransf_32 122..304 CDD:290402 72/272 (26%)
Mettl25NP_001101559.1 AdoMet_MTases 152..414 CDD:302624 72/272 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2651
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H32774
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007533
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12496
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
54.960

Return to query results.
Submit another query.