DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33964 and Orc3

Sequence 1:NP_001033941.1 Gene:CG33964 FlyBaseID:FBgn0053964 Length:484 Species:Drosophila melanogaster
Sequence 2:XP_006238057.1 Gene:Orc3 RGDID:1308457 Length:712 Species:Rattus norvegicus

Alignment Length:445 Identity:100/446 (22%)
Similarity:173/446 (39%) Gaps:105/446 (24%)


  Fly    55 KEDVALAIEDLFWKTD-ESE----RFPA----WREFLGKSKQERLSLHPKLLTSV--------EE 102
            |..:::.|||.|...: :||    ||..    |:....:::|.:..|:..|..::        .|
  Rat    19 KRKISVPIEDYFNNEELDSEDSKLRFETYRLLWQRIKSETEQLQEGLNENLFDNLVDFLQKSHSE 83

  Fly   103 LIEGQGN-STQLSIREFMSAKKC-------HEV---DLTAVL----VDQLVKNSGQDCFIVDAGD 152
            |.:..|| .:|:.:||..:|...       |:|   .||..|    ...:|....:||     .|
  Rat    84 LQKNSGNWGSQMRLREIPTAALILGVNVTDHDVIFRSLTETLHNNVTPYVVSLQAKDC-----PD 143

  Fly   153 GKGY---LSSRLALQYGHRVLGIDANAANTEN--ALNRNRKLQRAWNGLTERAELQVQGITPKRR 212
            .|.:   |:|.|.      ...:|.|:...:|  ||   |:...:.:.|:.......|...||..
  Rat   144 VKHFLQKLTSELI------DCCVDRNSKEEKNDKAL---RRTSYSMDSLSSWYSTVAQKTGPKMT 199

  Fly   213 SKKSPARESTKSAPALENYKTTAKFITTEL-NFGALLAENFTQFRPEDSPNICLTGL-------- 268
            |||.......:|.|.:...|....|.|..| :|..:.:::..:|     |.|.:.|:        
  Rat   200 SKKRATCSQWQSPPVVLILKNMESFSTKVLQDFIIISSQHLHEF-----PLILIFGIATSPVIIH 259

  Fly   269 ----HTCGNLAATCLQVFHAQTDCRLLCNVGCCYHLLRERYSQQEFFGNKSLMELQTDYGFPLSQ 329
                |:..:|  .|:::|.         ::.|..||        ....:|.|:..|    ||.. 
  Rat   260 RLLPHSVSSL--LCIELFQ---------SLSCKEHL--------TVVLDKLLLTPQ----FPFK- 300

  Fly   330 YLRERQVRMGRNARMLAAQSIERTLDTKELPNVTLYYRALLEILVCRHAPELKNEL------QVG 388
             |.::.:::..|..:....||:..:...:|..:..:|...|.:|.| ...|.|..:      |..
  Rat   301 -LSKKALQVLTNIFLYHDFSIQNFIKGLKLSLLEHFYSQPLSVLCC-DLSEAKKRINVFSVNQCE 363

  Fly   389 KVRKFESFEEYIQKCATKLDAPWLA--AVEKEELQSLLQEYAVHKYFLDLFYLLR 441
            |:|:..||..|::....:.....|.  ...|||.||||::  :|.|.::.|.:||
  Rat   364 KIRRLPSFRRYVENQPLEKQVALLTNETFLKEETQSLLED--LHVYHINYFLVLR 416

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33964NP_001033941.1 Methyltransf_32 122..304 CDD:290402 44/214 (21%)
Orc3XP_006238057.1 ORC3_N 18..343 CDD:284456 77/368 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.