DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33964 and orc3

Sequence 1:NP_001033941.1 Gene:CG33964 FlyBaseID:FBgn0053964 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_001342949.1 Gene:orc3 PomBaseID:SPAC3H1.01c Length:690 Species:Schizosaccharomyces pombe

Alignment Length:198 Identity:47/199 (24%)
Similarity:81/199 (41%) Gaps:35/199 (18%)


  Fly   268 LHTCGNLAATCLQVFHAQTDCRLLCNVGCCYHLLRERYSQQEFFGNKS----LMELQTDYGFPLS 328
            |:|..||... |::|....|.:.|.||            :.:.|..|:    |..|.|.....||
pombe   201 LYTIFNLKIP-LEMFDTSLDSKFLSNV------------KTKVFNMKASTEILESLFTSIEESLS 252

  Fly   329 QYLRERQVRMGRNARMLAAQSIERTLDTKELPNVTLYY---RALLEILVCRHAPELKNELQVGKV 390
            .....|..|..|:.....:.|:||.::......:|.:|   .:::|.|:.:....|.:.|.:..:
pombe   253 LKFGWRTRRFFRSMFYERSWSVERVIECIRYSILTHFYGNALSIIEHLIYQKDFHLISPLHLTTL 317

  Fly   391 RKFESFEEYIQKCATKLDAPWLAAVEKEELQSLLQEYAVHKYFLDLFYLLRMSFAPVLESLILLD 455
            |...||:.:|::           .:|..:|:|:  .| |.|...|..|...| ...:.|:|:..:
pombe   318 RTVPSFQRHIEQ-----------RLEIGDLESI--NY-VEKMLNDDTYFQEM-VIQMCENLLYRE 367

  Fly   456 RLL 458
            |||
pombe   368 RLL 370

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33964NP_001033941.1 Methyltransf_32 122..304 CDD:290402 10/36 (28%)
orc3NP_001342949.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.