DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33964 and ORC3

Sequence 1:NP_001033941.1 Gene:CG33964 FlyBaseID:FBgn0053964 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_862820.1 Gene:ORC3 HGNCID:8489 Length:712 Species:Homo sapiens

Alignment Length:437 Identity:99/438 (23%)
Similarity:173/438 (39%) Gaps:88/438 (20%)


  Fly    55 KEDVALAIEDLFWK-----TDESERFPA----WREFLGKSKQERL--SLHPKLLTSVEELIEGQG 108
            |..::|.|||.|.|     .|...||..    |::.  ||:.|||  .|:..|..::.|.::...
Human    19 KRKISLPIEDYFNKGKNEPEDSKLRFETYQLIWQQM--KSENERLQEELNKNLFDNLIEFLQKSH 81

  Fly   109 NSTQLSIREFMSAKKCHEV--------------DLTAVLVDQLVKNS---------GQDCFIVDA 150
            :..|.:.|:.....|..|:              |||...:.:.::|:         .:||     
Human    82 SGFQKNSRDLGGQIKLREIPTAALVLGVNVTDHDLTFGSLTEALQNNVTPYVVSLQAKDC----- 141

  Fly   151 GDGKGYLSSRLALQYGHRVLG--IDANAANTENALNRNRKLQRAWNGLTERAELQVQGITPKRRS 213
            .|.|.:|...::     :::.  :|..:...|:.....||...:.:.|:.......|...||..|
Human   142 PDMKHFLQKLIS-----QLMDCCVDIKSKEEESVHVTQRKTHYSMDSLSSWYMTVTQKTDPKMLS 201

  Fly   214 KKSPARESTKSAPALENYKTTAKFITTEL-NFGALLAENFTQFRPEDSPNICLTGLHTCGNLAAT 277
            ||.......:|.|.:...|....|.|..| :|..:.:::..:|     |.|.:.|:.|...:...
Human   202 KKRTTSSQWQSPPVVVILKDMESFATKVLQDFIIISSQHLHEF-----PLILIFGIATSPIIIHR 261

  Fly   278 CLQVFHAQTDCRLLC-----NVGCCYHLLRERYSQQEFFGNKSLMELQTDYGFPLSQYLRERQVR 337
            .|.  ||.:.  |||     ::.|..||....        :|.|:..|    ||..  :.|:.::
Human   262 LLP--HAVSS--LLCIELFQSLSCKEHLTTVL--------DKLLLTTQ----FPFK--INEKVLQ 308

  Fly   338 MGRNARMLAAQSIERTLDTKELPNVTLYYRALLEILVCRHAPELKNEL------QVGKVRKFESF 396
            :..|..:....|::..:...:|..:..:|...|.:|.| :.||.|..:      |...:|:..||
Human   309 VLTNIFLYHDFSVQNFIKGLQLSLLEHFYSQPLSVLCC-NLPEAKRRINFLSNNQCENIRRLPSF 372

  Fly   397 EEYIQKCATKLDAPWLAAVE--KEELQSLLQEYAVHKYFLDLFYLLR 441
            ..|::|.|::.....|....  |||.|.||:.  :|.|.::.|.:||
Human   373 RRYVEKQASEKQVALLTNERYLKEETQLLLEN--LHVYHMNYFLVLR 417

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33964NP_001033941.1 Methyltransf_32 122..304 CDD:290402 43/213 (20%)
ORC3NP_862820.1 ORC3_N 41..344 CDD:311159 67/338 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.