DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33964 and Rrnad1

Sequence 1:NP_001033941.1 Gene:CG33964 FlyBaseID:FBgn0053964 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_705790.3 Gene:Rrnad1 MGIID:2387197 Length:475 Species:Mus musculus

Alignment Length:507 Identity:136/508 (27%)
Similarity:218/508 (43%) Gaps:87/508 (17%)


  Fly     8 QLQRRLDGLLAFLNPHW-DFVNCHMVNYLTDQHWDGFLSETLKSEIAGKEDVALAIEDLFWKTD- 70
            ||...|..:||    |: ..::.:::.:.||..| |.|..:.:..:.|.....||...|....| 
Mouse    16 QLAVDLTRVLA----HYRSILDAYIIEFFTDSLW-GTLPHSWQEALDGLNPPQLATLLLGMPRDG 75

  Fly    71 ESERF-PAWREFLGKSKQERLSL----HPKLLTSVEELIEGQGNSTQLS--IREFMSAKKCHEVD 128
            |..|: ..|...|...|....:|    .|...|. .|.:|....|::|:  .|:.:..||.||:.
Mouse    76 EEMRYRSVWPLTLLALKSTACALAFTRTPGFHTP-SEFLENPSQSSRLTAPFRKHVKPKKQHEIR 139

  Fly   129 LTAVLVDQLVKNSGQDCF-IVDAGDGKGYLSSRLALQYGHRVLGIDANAANTENALNRNRKLQRA 192
            ....||.:|...:|  |. :||.|.|:|:||..::|..|..|..::.|....:.|.:.:::|.:|
Mouse   140 RLGELVKKLSDLTG--CTQVVDVGSGQGHLSRFMSLGLGLMVKSLEGNQRLVKRAQHLDQELLKA 202

  Fly   193 WNGLTERAELQVQGITPKRRSKKSPARESTKSAPALENYKTTAKFITTELNFGALLAENFTQFRP 257
            .:.:.:|....||     |..:..|.......:|.     |..:.:...|.            ||
Mouse   203 LDKMEKRHPKMVQ-----RGPRHRPHHVVQWVSPT-----TLCEELLLPLE------------RP 245

  Fly   258 -EDSPNICLTGLHTCGNLAATCLQVFHAQTDCRLLCNVGCCYHLLRERYSQQEFFGNKSLMELQT 321
             :.|..:.|||||.||:|:...|:.|....:...|.:|||||                  |:|..
Mouse   246 GQSSARLLLTGLHACGDLSVALLRHFCCCPEVVALASVGCCY------------------MKLSD 292

  Fly   322 DYGFPLSQYL-----RERQVRMGRNARMLAAQSIERTLDTKELPNVTLYYRALLEILVCRHAPEL 381
            ...:||||::     .|...|: |.....|.:.....|...|....|..:||.||.::.:..|||
Mouse   293 PGSYPLSQWIAGLPGHELPYRL-REGACHALEDYAERLHKAEPGLQTHCFRAALETVIRQVCPEL 356

  Fly   382 KNELQVGKVRKFE-SFEEYIQKCATK--------LDAPWLAAVEKEELQSLLQEYAVHKYFLDLF 437
            :.....|..|..| ..|||:::...:        ||   |||         ||.:...:..:..|
Mouse   357 RRPGVQGIPRVHELKIEEYVKQGLKRVGLDPQLPLD---LAA---------LQAHQAQENRVVAF 409

  Fly   438 YLLRMSFAPVLESLILLDRLLYLKELGYERSYLIDLFDPVISPRHFAIVSIK 489
            :.|.:..||::|:||||||:|||:|.|: .:.|:.:|.|.:|||:..:|:.|
Mouse   410 FSLALLLAPLVETLILLDRMLYLQEQGF-YAELLPIFSPELSPRNLVLVATK 460

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33964NP_001033941.1 Methyltransf_32 122..304 CDD:290402 50/184 (27%)
Rrnad1NP_705790.3 Methyltransf_32 133..293 CDD:290402 52/202 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2651
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5160
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.