DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33964 and Mettl25

Sequence 1:NP_001033941.1 Gene:CG33964 FlyBaseID:FBgn0053964 Length:484 Species:Drosophila melanogaster
Sequence 2:XP_011241713.1 Gene:Mettl25 MGIID:3041259 Length:646 Species:Mus musculus

Alignment Length:648 Identity:175/649 (27%)
Similarity:266/649 (41%) Gaps:189/649 (29%)


  Fly     9 LQRRLDGLLAFLNPHWDFVNCHMVNYLTDQHWDGFLSETLKSEIAGKEDVALAIEDLFWKTDESE 73
            |..:|.|||:||.......:.|.|::.|...|...:....:|.:|...:.|:..|..  :.:...
Mouse    19 LHDKLQGLLSFLRGALAISSAHTVDFYTKSVWQELVDLPPESVLAALRESAVEAEPR--EAETGS 81

  Fly    74 RFPAWREFLGKSKQERLSLHP-------------KLLTSVEELIEG-QGNSTQ-----LSIREFM 119
            .|....:...::.|:.||:..             .|.|..|:|:.. |||..|     :...|||
Mouse    82 GFTELPKIFCETSQKLLSVEAFARTAKHYSVQNLGLCTPSEQLLTALQGNKRQRVDENVKAIEFM 146

  Fly   120 SAKKCHEVDLTAVLVDQLVKNSGQDCFIVDAGDGKGYLSSRLALQYGHRVLGIDANAANTENALN 184
            :.||.|||...:.|:..:....|.. .|:|.|.|||||||.|:|:||..|.|||::..||..|..
Mouse   147 NTKKSHEVQAMSELICSIADYCGLK-QIIDVGSGKGYLSSFLSLKYGLNVYGIDSSNTNTHGAKE 210

  Fly   185 RNRKLQRAW-------------------------------------------------------- 193
            |||||::.|                                                        
Mouse   211 RNRKLKKHWSLYHPHSRADANGWASERPRELKVPKGVECKGDAESVQRSRLGNPDLSATDGLPDF 275

  Fly   194 -------------NGLTERAE-------------------------LQVQ-----GITPKRRSKK 215
                         |.|.:.||                         .|||     |:..:||:..
Mouse   276 SGSAISVIRKQQKNVLAQPAEEENLYFEDAFSLIDFLPVDAIEPTSSQVQNTEKSGLRKERRNTA 340

  Fly   216 SPARESTKSAPALENYKTTAKFITTELNFGALLAENFTQFRPEDSPNICLTGLHTCGNLAATCLQ 280
            |.||:|:       .|.....|||.:.....::         ||..:..:.||||||:||.:.|:
Mouse   341 SKARDSS-------IYSPLTSFITADSQLHDII---------EDLEDCLMVGLHTCGDLAPSTLR 389

  Fly   281 VFHAQTDCRLLCNVGCCYHLLRERYSQQEFFGNKSLMELQTDYGFPLSQYLRERQVRMGRNARML 345
            :|.::.:.:.:|:||||||||.|.:..|.  .::...|   ::|||:..||:|.:...||||||.
Mouse   390 IFTSKAEVKAVCSVGCCYHLLSEEFENQH--KDRCANE---NWGFPMCHYLKEERWCCGRNARMS 449

  Fly   346 AAQSIERTLDTKELPNVTLYYRALLEILVCRHAPELKNELQVGKV-RKFESFEEYIQKCATKL-- 407
            |..:::|....:.||..:|:|||:|:.::..:....|.|..|||: .|..||.||::....||  
Mouse   450 ACLALQRVAVGQGLPTESLFYRAVLQNIIKDYYGISKCEQHVGKIYSKCSSFLEYVRMSLKKLGL 514

  Fly   408 -----------------------------------DAPWLAA--------VEKEELQSLLQEYAV 429
                                               |.|..:.        |.:|.:....:.|..
Mouse   515 DESKRHFQELQSVCCVLCSRWEQNLLDVFYVRLIYDRPGCSLCPMVGFLNVSEEIIMDYYENYKP 579

  Fly   430 HKYFLDLFYLLRMSFAPVLESLILLDRLLYLKEL-GYERSYLIDLFDPVISPRHFAIVSIKQQ 491
            ....|:.|.:|::..||.:|:|||||||.||||. |...|.|:.|||||.|||.:|::::|:|
Mouse   580 RMNELEAFNMLKVVLAPCIETLILLDRLCYLKEQDGVAWSALVKLFDPVQSPRCYAVIALKKQ 642

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33964NP_001033941.1 Methyltransf_32 122..304 CDD:290402 74/281 (26%)
Mettl25XP_011241713.1 AdoMet_MTases 149..413 CDD:302624 74/281 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2651
Hieranoid 1 1.000
Homologene 1 1.000 H32774
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007533
OrthoInspector 1 1.000 T1083266
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12496
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5160
TreeFam 1 0.960
109.910

Return to query results.
Submit another query.