DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33964 and F25H2.12

Sequence 1:NP_001033941.1 Gene:CG33964 FlyBaseID:FBgn0053964 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_492768.1 Gene:F25H2.12 WormBaseID:WBGene00009123 Length:478 Species:Caenorhabditis elegans

Alignment Length:547 Identity:141/548 (26%)
Similarity:230/548 (42%) Gaps:140/548 (26%)


  Fly     6 VVQLQRRL---DGLLAFLNPHWDFVNCHMVNYLTDQHWDGFLS-ETLKSEI-----------AGK 55
            ||...||:   ..:..|.:..||         |.:..|..:|: |:|:..|           |..
 Worm     9 VVSKYRRILNSRSIEYFASSSWD---------LLEDEWREYLNLESLEDVIVFVNSSDNLVSADC 64

  Fly    56 EDVALAIED------LFWKTDESERFPA--WREFLGKSKQERLSLHPKLLTSVEELIEGQGNSTQ 112
            ..:..::.|      ||....:....|:  ||::.|.:: :.|:...:.::|...|         
 Worm    65 ASIPHSLRDLKANLKLFEYNRKCVENPSDLWRQWTGTTR-DGLNASFRTISSANGL--------- 119

  Fly   113 LSIREFMSAKKCHEVDLTAVLVDQL---VKNSGQDC-FIVDAGDGKGYLSSRLALQYGHRVLGID 173
              :|:.:.|||.||:|....|:.|:   .|:|.... .:||.|.|.|:||..:::.....|:.::
 Worm   120 --VRKRIKAKKQHEIDRIVELISQIQIFQKDSADPIDSLVDIGAGIGHLSRMISIHNNISVMAVE 182

  Fly   174 ANAANTENALNRNRKLQRAWNGLTERAELQVQGITPKRRSKKSPARESTKSAPALENY--KTT-- 234
            .           |::...|.|.|.|:..|                 :|.|....:||:  |:|  
 Worm   183 G-----------NQQFTLAANSLDEKLLL-----------------DSAKIGSRIENFNVKSTPI 219

  Fly   235 --AKFITTELNFGALLAENFTQFRPEDSPNICLTGLHTCGNLAATCLQVFHAQTDCRLLCNVGCC 297
              ..|:|.:|   ||..::|.      ..:..|.|||.||:.::|.|:||......:.|...|||
 Worm   220 RYTNFVTEDL---ALKIDDFA------VNSAILVGLHCCGDFSSTILKVFQKSEKSKALVLFGCC 275

  Fly   298 Y-------HLLRERYSQQEFFGNKSLMELQTDYG----FPLSQ---------YLRERQVRMGRNA 342
            |       |.||...::.|    :.:.| .|.:|    ||||:         .|||.......|.
 Worm   276 YHKEFQCFHFLRPENNENE----REISE-NTSFGKSTVFPLSKKWENVEIDYLLREAACHNNENL 335

  Fly   343 RMLAAQSIERTLDTKELPNVTLYYRALLEILVCRHAPELKNELQVG--KVRKFE---SFEEYIQK 402
            .       ||.|  |:..:::.|.|:.||..:.: ..||..:..:|  .|:..|   :|||||:|
 Worm   336 E-------ERFL--KQKIDLSRYARSYLEKWIWK-VSELPEDRNIGMCSVKCIENQTTFEEYIRK 390

  Fly   403 CATK-----LDAPWLAAVEKEELQSLLQEYAVHKYFLDLFYLLRMSFAPVLESLILLDRLLYLKE 462
            ....     ||.. |..:.:.||.:.:......::  |.|.:||..|||.:||.|:.||:..|:|
 Worm   391 AMANRGNHLLDKV-LQIIPQSELSAHVSSLRSSQF--DSFEVLRCMFAPAIESAIIDDRVELLRE 452

  Fly   463 LGYERSYLIDLFDPVISPRHFAIVSIK 489
            .|. .|.::.||:|.||||:.||::.|
 Worm   453 NGI-NSRVVPLFEPSISPRNLAIIAYK 478

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33964NP_001033941.1 Methyltransf_32 122..304 CDD:290402 53/199 (27%)
F25H2.12NP_492768.1 AdoMet_MTases 127..278 CDD:302624 50/188 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2651
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.698 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5160
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.