DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33964 and orc3

Sequence 1:NP_001033941.1 Gene:CG33964 FlyBaseID:FBgn0053964 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_001096537.1 Gene:orc3 XenbaseID:XB-GENE-984200 Length:709 Species:Xenopus tropicalis

Alignment Length:462 Identity:93/463 (20%)
Similarity:162/463 (35%) Gaps:126/463 (27%)


  Fly    55 KEDVALAIEDLFWK-----TDESERFPA----WREFLGKSKQERLSLHPKLLTSVEELIEGQGNS 110
            |:...|.:.|.|.:     .|..:||.:    |::...:::|.:..|:.:|.   |.||    ..
 Frog    19 KKKTTLTVADYFNEGLKDSEDGKKRFESCQLLWQQMKSQTEQLQEELNKRLF---ENLI----GF 76

  Fly   111 TQLSIREFMSAK-------KCHEVDLTAVLV-------DQLVKNS-----------------GQD 144
            .:.|..:|...|       :..|:. ||.||       ..|..||                 .::
 Frog    77 LRKSHADFHDKKDDWSCRMRASEIP-TAALVLGVNVTDHDLTFNSLADILHETITPYVVLLQSKE 140

  Fly   145 CFIVDAGDGKGYLSSRLALQYGHRVLGIDANAANTENALNRNRKLQ---RAWNGLTERAELQVQG 206
            |      .|...|..:|.:|.......|:.:....:..::: ||:.   .:.:|..:||  ..:.
 Frog   141 C------PGIKQLLQKLLIQLMGNTADIELDEEEEQVTISQ-RKMNCSLASLSGWYKRA--TKKP 196

  Fly   207 ITPKRRSKKSPARESTKSAPALENYKTTAKFITTELNFGALLAENFTQFRPEDSPNICLTGLHTC 271
            .:||:  |:|......:|.|.:..:|....|..:.|....:::..:.|    :.|.:.:.|:   
 Frog   197 ASPKK--KRSSTSTHWESPPVVVIFKDLESFTASVLQEFIVISSGYVQ----ELPLVLVFGI--- 252

  Fly   272 GNLAATCLQVFHAQTDCRLLCNVGCCYHLLRERYSQQEFFGNKSLME----------LQTDYGFP 326
                ||...:.|     |||.      |.:..|.. .|.|.:.|..|          |...:.|.
 Frog   253 ----ATSPMIIH-----RLLS------HSVSSRLC-IELFQSMSCTEHLATVVDQLLLTNHFPFK 301

  Fly   327 LSQYLRERQVRMGRNARMLAA------QSIERTLDTKELPNVTLYYRALLEILVCRHAPE----L 381
            ||          ||..::|..      .|::..:...:|..|..:|...|.:|.| ..||    :
 Frog   302 LS----------GRALQVLITIFLYHDFSVQNFIKGPQLSVVEHFYTQPLSVLCC-SLPESRKRI 355

  Fly   382 KN--ELQVGKVRKFESFEEYIQKCATKLDAPWLAAVEKEELQSLLQEYAVHKYFLDLFYLLRMSF 444
            ||  ..|...:|...||..|::....:.....|  .....|:.:.||      ||:.......:|
 Frog   356 KNLSHAQCENIRHLSSFMSYVESQTPENQVKLL--TNDSFLKEMTQE------FLERLTSYHENF 412

  Fly   445 APVLESL 451
            .|:|..|
 Frog   413 TPILRCL 419

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33964NP_001033941.1 Methyltransf_32 122..304 CDD:290402 39/216 (18%)
orc3NP_001096537.1 ORC3_N 41..344 CDD:311159 67/355 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.