DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: wmd and Strap

Sequence 1:NP_001097436.1 Gene:wmd FlyBaseID:FBgn0034876 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_035629.2 Gene:Strap MGIID:1329037 Length:350 Species:Mus musculus

Alignment Length:318 Identity:193/319 (61%)
Similarity:244/319 (76%) Gaps:1/319 (0%)


  Fly     6 LRQIPLTCSGHTRPVVHLDFSDICDAGYFLISACKDGSPMLRHGDTGDWVGTFEGHKGAVWNATL 70
            :||.||||||||||||.|.||.|...|||||||||||.||||.||||||:|||.|||||||.|||
Mouse     3 MRQTPLTCSGHTRPVVDLAFSGITPYGYFLISACKDGKPMLRQGDTGDWIGTFLGHKGAVWGATL 67

  Fly    71 NRNATLAASGAADFTGKVWNAVTGAEIHSFQHKHIVKSVAFDRDSENIVTGSNEKLVRVFNLEQP 135
            |::||.||:.|||||.|||:||:|.|:.:..||||||:|.|.:||..::||..:||:|:::|.:|
Mouse    68 NKDATKAATAAADFTAKVWDAVSGDELMTLAHKHIVKTVDFTQDSNYLLTGGQDKLLRIYDLNKP 132

  Fly   136 EAQPEEYAGHTGAIKRALFCRGDKCIISAAEDKTVRLWDRMTGIEVQRLQFNSNPNSLEISSDNH 200
            ||:|:|.:|||..||:||:|..||.|:| |:||||||||..|..||:.|.||.:.:|:|...:..
Mouse   133 EAEPKEISGHTSGIKKALWCSDDKQILS-ADDKTVRLWDHATMTEVKSLNFNMSVSSMEYIPEGE 196

  Fly   201 ILTISHGSSISFWEIDTLKKLKEVKVPTNVASASLHPDKHVFVCGGEDFKMYKFDYITGNEIESF 265
            ||.|::|.||:|....:|:.:|..:.|..:.||||||:|...|.||||||:||:||.:|.|:||:
Mouse   197 ILVITYGRSIAFHSAVSLEPIKSFEAPATINSASLHPEKEFLVAGGEDFKLYKYDYNSGEELESY 261

  Fly   266 KGHFGPVHSVKFSPDGELYASGSEDGTLRLWQTTVGKTYGLWKCTEPADLGNSISSPR 323
            ||||||:|.|:||||||||||||||||||||||.||||||||||..|.:....::.|:
Mouse   262 KGHFGPIHCVRFSPDGELYASGSEDGTLRLWQTVVGKTYGLWKCVLPEEDSGELAKPK 319

Known Domains:


GeneSequenceDomainRegion External IDIdentity
wmdNP_001097436.1 WD40 <4..296 CDD:225201 178/290 (61%)
WD40 12..297 CDD:238121 175/285 (61%)
WD40 repeat 25..60 CDD:293791 27/35 (77%)
WD40 repeat 66..101 CDD:293791 21/35 (60%)
WD40 repeat 108..144 CDD:293791 15/36 (42%)
WD40 repeat 150..186 CDD:293791 21/36 (58%)
WD40 repeat 190..225 CDD:293791 11/35 (31%)
WD40 repeat 231..266 CDD:293791 22/35 (63%)
WD40 repeat 272..308 CDD:293791 32/36 (89%)
StrapNP_035629.2 WD40 9..293 CDD:238121 175/285 (61%)
WD40 <11..292 CDD:225201 172/282 (61%)
WD 1 12..56 35/44 (80%)
WD 2 57..96 27/39 (69%)
WD 3 98..137 20/39 (51%)
WD40 repeat 104..141 CDD:293791 16/37 (43%)
WD 4 141..179 24/39 (62%)
WD40 repeat 146..181 CDD:293791 22/36 (61%)
WD 5 180..212 12/32 (38%)
WD40 repeat 187..221 CDD:293791 11/34 (32%)
WD 6 221..262 23/41 (56%)
WD40 repeat 226..262 CDD:293791 22/36 (61%)
WD 7 263..302 35/39 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C137741038
eggNOG 1 0.900 E1_KOG0278
Hieranoid 1 1.000
Homologene 1 1.000 H43881
Inparanoid 1 1.050 412 1.000 Inparanoid score I1833
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007718
OrthoInspector 1 1.000 T1085459
orthoMCL 1 0.900 OOG5_129553
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5798
TreeFam 1 0.960
1211.690

Return to query results.
Submit another query.