DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: wmd and LOC100910575

Sequence 1:NP_001097436.1 Gene:wmd FlyBaseID:FBgn0034876 Length:328 Species:Drosophila melanogaster
Sequence 2:XP_003749912.2 Gene:LOC100910575 RGDID:6498120 Length:279 Species:Rattus norvegicus

Alignment Length:277 Identity:153/278 (55%)
Similarity:200/278 (72%) Gaps:11/278 (4%)


  Fly     6 LRQIPLTCSGHTRPVVHLDFSDICDAGYFLISACKDGSPMLRHGDTGDWVGTFEGHKGAVWNATL 70
            :||.||||||||||||.|.||.|...|||||||||||.||||.||||||:|||.|||||||.|||
  Rat     3 MRQTPLTCSGHTRPVVDLAFSGITPYGYFLISACKDGKPMLRQGDTGDWIGTFLGHKGAVWGATL 67

  Fly    71 NRNATLAASGAADFTGKVWNAVTGAEIHSFQHKHIVKSVAFDRDSENIVTGSNEKLVRVFNLEQP 135
            |::||.||:.|||||.|||:||:|.|:.:..||||||:|.|.:||..::||..:||:|:::|.:|
  Rat    68 NKDATKAATAAADFTAKVWDAVSGDELMTLAHKHIVKTVDFTQDSNYLLTGGQDKLLRIYDLNKP 132

  Fly   136 EAQPEEYAGHTGAIKRALFCRGDKCIISAAEDKTVRLWDRMTGIEVQRLQFNSNPNSLEISSDNH 200
            ||:|:|.:|||..||:||:|..||.|:| |:||||||||..|..||:.|.||.:.:|:|...:..
  Rat   133 EAEPKEISGHTSGIKKALWCSEDKQILS-ADDKTVRLWDHATMTEVKSLNFNMSVSSMEYIPEGE 196

  Fly   201 ILTISHGSSISFWEIDTLKKLKEVKVPTNVASASLHPDKHVFVCGGEDFKMYKFDYITGNEIESF 265
            ||.|::|.||:|....:|:.:|..:.|..:.||||||:|...|.||||||:||:||.:|.|:   
  Rat   197 ILVITYGRSIAFHSAVSLEPIKSFEAPATINSASLHPEKEFLVAGGEDFKLYKYDYNSGEEL--- 258

  Fly   266 KGHFGPVHS---VKFSP 279
                |..||   :::.|
  Rat   259 ----GESHSLPLIRYLP 271

Known Domains:


GeneSequenceDomainRegion External IDIdentity
wmdNP_001097436.1 WD40 <4..296 CDD:225201 153/278 (55%)
WD40 12..297 CDD:238121 149/272 (55%)
WD40 repeat 25..60 CDD:293791 27/35 (77%)
WD40 repeat 66..101 CDD:293791 21/35 (60%)
WD40 repeat 108..144 CDD:293791 15/36 (42%)
WD40 repeat 150..186 CDD:293791 21/36 (58%)
WD40 repeat 190..225 CDD:293791 11/35 (31%)
WD40 repeat 231..266 CDD:293791 20/35 (57%)
WD40 repeat 272..308 CDD:293791 3/12 (25%)
LOC100910575XP_003749912.2 WD40 9..260 CDD:295369 146/259 (56%)
WD40 <11..263 CDD:225201 145/260 (56%)
WD40 repeat 104..141 CDD:293791 16/37 (43%)
WD40 repeat 146..181 CDD:293791 22/36 (61%)
WD40 repeat 187..221 CDD:293791 11/34 (32%)
WD40 repeat 226..260 CDD:293791 21/41 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C137742497
eggNOG 1 0.900 E1_KOG0278
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1239790at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR44156
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.