DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33640 and CG33721

DIOPT Version :10

Sequence 1:NP_001027255.2 Gene:CG33640 / 3772680 FlyBaseID:FBgn0053640 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001036743.1 Gene:CG33721 / 3885576 FlyBaseID:FBgn0053721 Length:181 Species:Drosophila melanogaster


Alignment Length:118 Identity:23/118 - (19%)
Similarity:39/118 - (33%) Gaps:52/118 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 RSYLSGHMMINRLVNDLTLTSSMDITRPQRPELRLYNVQLNFCSVLNNGYK----NKFIRMLYNN 112
            |||:           .:|:.:|:|:                 |..:  .||    |..:|:....
  Fly    82 RSYM-----------PITIAASIDV-----------------CKYM--AYKKNLANPMLRLFEEI 116

  Fly   113 YAQFLNTKPKCPLKPNFNYSLHRAYIDEAMLPDLLPECTYRLKMSFKHKSKLL 165
            ..::.||..|||             .|..::.|.||.     |...:|.:.:|
  Fly   117 TKKYTNTNHKCP-------------YDHDLIIDRLPS-----KYLSEHFTNIL 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33640NP_001027255.2 DUF1091 73..154 CDD:461928 16/84 (19%)
CG33721NP_001036743.1 DUF1091 74..160 CDD:461928 23/118 (19%)

Return to query results.
Submit another query.