DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33640 and CG13590

DIOPT Version :8

Sequence 1:NP_001027255.2 Gene:CG33640 / 3772680 FlyBaseID:FBgn0053640 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_611919.1 Gene:CG13590 / 37907 FlyBaseID:FBgn0035012 Length:193 Species:Drosophila melanogaster

Alignment Length:169 Identity:33/169 - (19%)
Similarity:63/169 - (37%) Gaps:40/169 - (23%)


  Fly     4 HKLRLLVFSSLINCSLCAHVVFVDHFTFTVDDRDLFLSQSAVVEQDGNRSYLSGHMMINRLVNDL 68
            |..||..:|. ...||..:|.||:      ..|::.:....:.:.:|.:.:|.          |.
  Fly    43 HYCRLKAYSR-AKTSLNINVTFVE------PARNISVHFKTMKKANGYKPFLF----------DY 90

  Fly    69 TLTSSMDITRPQRPELRLYNVQLNFCSVLNNGYKNKFIRMLYNNYAQFLNTKPKCPLKPNFNYSL 133
            |..:...:.|..:|..::....:...|.:|:....:.::||    :.|.......|| |:.:|.|
  Fly    91 TFDACEFMRRRNQPVAKIIWYMIRNVSTINHTCPYEGLQML----SDFHKVDIPVPL-PSGDYLL 150

  Fly   134 HRAYIDE-----------AMLPDLLPECTYRLKMSFKHK 161
            ...::.:           ..:.||||       .|.||:
  Fly   151 MVDWLFDGKTQFATNVYFTFIEDLLP-------TSSKHR 182

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33640NP_001027255.2 DUF1091 73..154 CDD:284008 16/91 (18%)
CG13590NP_611919.1 DM8 83..171 CDD:214778 15/102 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.