powered by:
Protein Alignment CG33640 and CG33923
DIOPT Version :9
| Sequence 1: | NP_001027255.2 |
Gene: | CG33640 / 3772680 |
FlyBaseID: | FBgn0053640 |
Length: | 178 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_001027216.2 |
Gene: | CG33923 / 3772652 |
FlyBaseID: | FBgn0053923 |
Length: | 178 |
Species: | Drosophila melanogaster |
| Alignment Length: | 39 |
Identity: | 13/39 - (33%) |
| Similarity: | 18/39 - (46%) |
Gaps: | 0/39 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 86 LYNVQLNFCSVLNNGYKNKFIRMLYNNYAQFLNTKPKCP 124
||||.::.|....|...|...|.||:.:..:.|....||
Fly 87 LYNVTIDACKFYKNQKSNPIARYLYSFFKDYSNINHSCP 125
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
1 |
1.100 |
- |
- |
P |
PTHR20898 |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.