DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33640 and CG33923

DIOPT Version :10

Sequence 1:NP_001027255.2 Gene:CG33640 / 3772680 FlyBaseID:FBgn0053640 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027216.2 Gene:CG33923 / 3772652 FlyBaseID:FBgn0053923 Length:178 Species:Drosophila melanogaster


Alignment Length:39 Identity:13/39 - (33%)
Similarity:18/39 - (46%) Gaps:0/39 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 LYNVQLNFCSVLNNGYKNKFIRMLYNNYAQFLNTKPKCP 124
            ||||.::.|....|...|...|.||:.:..:.|....||
  Fly    87 LYNVTIDACKFYKNQKSNPIARYLYSFFKDYSNINHSCP 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33640NP_001027255.2 DUF1091 73..154 CDD:461928 13/39 (33%)
CG33923NP_001027216.2 DUF1091 72..157 CDD:461928 13/39 (33%)

Return to query results.
Submit another query.