DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33640 and CG33795

DIOPT Version :10

Sequence 1:NP_001027255.2 Gene:CG33640 / 3772680 FlyBaseID:FBgn0053640 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027129.2 Gene:CG33795 / 3772625 FlyBaseID:FBgn0053795 Length:178 Species:Drosophila melanogaster


Alignment Length:123 Identity:25/123 - (20%)
Similarity:50/123 - (40%) Gaps:6/123 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 NRSYLSGHMMINRLVNDLTLTSSMDITRPQRPELRLYNVQLNFCSVLNNGYKNKFIRMLYNNYAQ 115
            ||:..:.:..|:...||:.:.... :.|....:..||...::.|..|...| :...:|:|..:..
  Fly    54 NRTVFNFNATIHHPTNDVVIDYRF-LKRENGYKPWLYKKNIDGCRFLRKPY-DMLTKMIYMVFKP 116

  Fly   116 FLNTKPKCPLKPNFNYSLHRAYIDEAMLPDLLPECTYRLKM--SFKHKSKLLAHMQID 171
            |.|....||...:.  .:...|:...:.....|...|.|::  ||..|.:::.::..|
  Fly   117 FSNINHTCPFYGDI--LIRGMYLRTEIKAMPYPSGKYMLQINWSFYKKIQVVTNISYD 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33640NP_001027255.2 DUF1091 73..154 CDD:461928 15/80 (19%)
CG33795NP_001027129.2 DUF1091 77..153 CDD:461928 15/79 (19%)

Return to query results.
Submit another query.