DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33640 and CG33784

DIOPT Version :10

Sequence 1:NP_001027255.2 Gene:CG33640 / 3772680 FlyBaseID:FBgn0053640 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027169.1 Gene:CG33784 / 3772181 FlyBaseID:FBgn0053784 Length:183 Species:Drosophila melanogaster


Alignment Length:96 Identity:21/96 - (21%)
Similarity:42/96 - (43%) Gaps:17/96 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 LYNVQLNFCSVLNNGYKNKFIRMLYNNYAQFLNTKPKCPLKPNFNYSLHRAYIDEAMLPD----- 145
            |:||.::.|..|.:..:..|..::|:....|.|....||    ||   |...:::.:|.|     
  Fly    90 LFNVTVDVCHFLKHRKRYPFADLVYDGIKSFSNLNHTCP----FN---HDIIVNQMVLNDDMISK 147

  Fly   146 -LLPECTYRLKMSFK----HKSKLLAHMQID 171
             .:|...|:|:...|    .:.::..|.:::
  Fly   148 APVPNGFYKLRFIVKTDGVWRGEVEVHAEVN 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33640NP_001027255.2 DUF1091 73..154 CDD:461928 18/73 (25%)
CG33784NP_001027169.1 DUF1091 76..157 CDD:461928 18/73 (25%)

Return to query results.
Submit another query.