DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33640 and CG33775

DIOPT Version :10

Sequence 1:NP_001027255.2 Gene:CG33640 / 3772680 FlyBaseID:FBgn0053640 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027410.1 Gene:CG33775 / 3772054 FlyBaseID:FBgn0053775 Length:182 Species:Drosophila melanogaster


Alignment Length:76 Identity:18/76 - (23%)
Similarity:35/76 - (46%) Gaps:7/76 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 LYNVQLNFCSVLNNGYKNKFIRMLYNNYAQFLNTKPKCPLKPNFNYSL---HRAYIDEAMLPDLL 147
            ||||..:.|.:|.|.....|..::.|...:..|....||    :|:.:   :..:.|:.:....|
  Fly    93 LYNVSTDLCQLLGNPNAISFQGLVINAIKKGSNLNHSCP----YNHDIIVDNMEFSDDFLKTLPL 153

  Fly   148 PECTYRLKMSF 158
            |:..|::::.|
  Fly   154 PQGVYKIQLRF 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33640NP_001027255.2 DUF1091 73..154 CDD:461928 17/70 (24%)
CG33775NP_001027410.1 DUF1091 78..160 CDD:461928 17/70 (24%)

Return to query results.
Submit another query.