DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33640 and CG33647

DIOPT Version :8

Sequence 1:NP_001027255.2 Gene:CG33640 / 3772680 FlyBaseID:FBgn0053640 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027136.1 Gene:CG33647 / 3772049 FlyBaseID:FBgn0053647 Length:190 Species:Drosophila melanogaster

Alignment Length:83 Identity:18/83 - (21%)
Similarity:36/83 - (43%) Gaps:0/83 - (0%)


  Fly    91 LNFCSVLNNGYKNKFIRMLYNNYAQFLNTKPKCPLKPNFNYSLHRAYIDEAMLPDLLPECTYRLK 155
            :::|.:|::...:...||:.....:..|...:||||.|..|......::...:|..:||..:...
  Fly    95 VDYCQMLSSVENHFLFRMVTTQLRETANFPIQCPLKMNKRYYAKGFTVNSKFIPSYMPETNFISD 159

  Fly   156 MSFKHKSKLLAHMQIDGR 173
            .....|.:.:..:.|.||
  Fly   160 AHLSVKDRKVFRLLIKGR 177

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33640NP_001027255.2 DUF1091 73..154 CDD:284008 14/62 (23%)
CG33647NP_001027136.1 DUF1091 <95..156 CDD:284008 14/60 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2FA0X
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.