powered by:
Protein Alignment CG33640 and CG33922
DIOPT Version :8
Sequence 1: | NP_001027255.2 |
Gene: | CG33640 / 3772680 |
FlyBaseID: | FBgn0053640 |
Length: | 178 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001027217.1 |
Gene: | CG33922 / 3771945 |
FlyBaseID: | FBgn0053922 |
Length: | 178 |
Species: | Drosophila melanogaster |
Alignment Length: | 39 |
Identity: | 10/39 - (25%) |
Similarity: | 16/39 - (41%) |
Gaps: | 0/39 - (0%) |
Fly 86 LYNVQLNFCSVLNNGYKNKFIRMLYNNYAQFLNTKPKCP 124
||||.::.|....:...|......:|.:..:.|....||
Fly 87 LYNVTVDGCRFYKHQRSNPVFSYFFNFFKDYSNINHSCP 125
|
Known Domains:
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
|
|
P |
PTHR20898 |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.