DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33640 and CG33645

DIOPT Version :8

Sequence 1:NP_001027255.2 Gene:CG33640 / 3772680 FlyBaseID:FBgn0053640 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027260.3 Gene:CG33645 / 3771913 FlyBaseID:FBgn0053645 Length:189 Species:Drosophila melanogaster

Alignment Length:168 Identity:47/168 - (27%)
Similarity:82/168 - (48%) Gaps:2/168 - (1%)


  Fly     9 LVFSSLINCSLCAHVVFVDHFTFTVDDRDLFLSQSAVVEQDGNRSYLSGHMMINRLVNDLTLTSS 73
            |:|:|: .|......|::.....|..|.||:......|.|..||:|:....:..|.|:|:|:.::
  Fly    12 LIFNSM-RCEERNFRVYIKEVNITHLDTDLYEKFECKVYQVDNRTYMDSVHIFKRTVDDITVHAA 75

  Fly    74 MDITR-PQRPELRLYNVQLNFCSVLNNGYKNKFIRMLYNNYAQFLNTKPKCPLKPNFNYSLHRAY 137
            :|..: ..:.:::||:||.|.|.:|.|..||:...|...|..:..|.|.|||.:.|.:|.:....
  Fly    76 LDFWKLNSKQKMKLYDVQFNGCYILENANKNRLFNMYVQNLKKHSNVKFKCPFRANVSYEVKNLT 140

  Fly   138 IDEAMLPDLLPECTYRLKMSFKHKSKLLAHMQIDGRLL 175
            :.|...|..:|...:|..:.:....||.|.:...|::|
  Fly   141 MSEQDFPSFVPLGKFRSLIEYCTNQKLRARVIASGQIL 178

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33640NP_001027255.2 DUF1091 73..154 CDD:284008 23/81 (28%)
CG33645NP_001027260.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.