DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33640 and CG33642

DIOPT Version :8

Sequence 1:NP_001027255.2 Gene:CG33640 / 3772680 FlyBaseID:FBgn0053640 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027257.1 Gene:CG33642 / 3771733 FlyBaseID:FBgn0053642 Length:187 Species:Drosophila melanogaster

Alignment Length:173 Identity:46/174 (26%)
Similarity:88/174 (51%) Gaps:5/174 (3%)


  Fly     8 LLVFSSLINCSLCAHVVF---VDHFTFTVDDRDLFLSQSAVVEQDGNRSYLSGHMMINRLVNDLT 69
            ||.|::.| |..|....|   ::.|......|||.......:....||||::|.|::...|.|:.
  Fly    12 LLWFTNHI-CLKCEERSFRIKMNEFAVKYKMRDLIQHIDFRIVNLNNRSYVNGEMIVKSDVEDIL 75

  Fly    70 LTSSMDITR-PQRPELRLYNVQLNFCSVLNNGYKNKFIRMLYNNYAQFLNTKPKCPLKPNFNYSL 133
            :.::||..: ..:.:::||:.:|:.|..|...::|...::...::.:.::....|||:.||||:|
  Fly    76 MHTTMDFWKTSNQKKIKLYDGRLDACQFLKTSHRNGLFKIYVKSFKKHIHGNLSCPLRTNFNYTL 140

  Fly   134 HRAYIDEAMLPDLLPECTYRLKMSFKHKSKLLAHMQIDGRLLS 176
            ...::||..||..:|..|:|....:..:.:|...:...|::||
  Fly   141 TNWHMDEKDLPPFVPLGTFRTVTEYFTQDRLALRIVTQGKVLS 183

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33640NP_001027255.2 DUF1091 73..154 CDD:284008 23/82 (28%)
CG33642NP_001027257.1 DUF1091 79..160 CDD:284008 22/81 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2FA0X
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.