DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33640 and CG33483

DIOPT Version :10

Sequence 1:NP_001027255.2 Gene:CG33640 / 3772680 FlyBaseID:FBgn0053640 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001189327.1 Gene:CG33483 / 2768693 FlyBaseID:FBgn0053483 Length:229 Species:Drosophila melanogaster


Alignment Length:86 Identity:17/86 - (19%)
Similarity:25/86 - (29%) Gaps:32/86 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 LYNVQLNFCSVLNNGYKNKFIRMLYNNYAQFLNTKPKCP---------LKPNF------------ 129
            |||:.::.|..|.:...|......|..:....|....||         |..||            
  Fly   138 LYNITVDACKALRHSKYNPIFSFFYGLFKHHSNMNHTCPFDHDLIVEKLPTNFMNQKVNGDIKFP 202

  Fly   130 -----------NYSLHRAYID 139
                       .|.::||.:|
  Fly   203 HGDYLFHSDWYAYGINRATVD 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33640NP_001027255.2 DUF1091 73..154 CDD:461928 17/86 (20%)
CG33483NP_001189327.1 DUF1091 123..208 CDD:461928 13/69 (19%)

Return to query results.
Submit another query.