powered by:
                  
 
    
 
    
             
          
            Protein Alignment bbx and SOX14
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_001027087.1 | 
            Gene: | bbx / 3772670 | 
            FlyBaseID: | FBgn0024251 | 
            Length: | 769 | 
            Species: | Drosophila melanogaster | 
          
          
            | Sequence 2: | NP_004180.1 | 
            Gene: | SOX14 / 8403 | 
            HGNCID: | 11193 | 
            Length: | 240 | 
            Species: | Homo sapiens | 
          
        
        
        
          
            | Alignment Length: | 169 | 
            Identity: | 46/169 - (27%) | 
          
          
            | Similarity: | 71/169 -  (42%) | 
            Gaps: | 31/169 - (18%) | 
          
        
      
- Green bases have known domain annotations that are detailed below.
      | 
 
  Fly   291 TRPEHHARRPMNAFLIFCKRHRGIVKERYKTLENRAITKILGDWWAALDEQEKHCFTDLAQQNKD 355 
            ::|..|.:||||||:::.:..|..:.:....:.|..|:|.||..|..|.|.||..:.|.|::.:. 
Human     2 SKPSDHIKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSEAEKRPYIDEAKRLRA 66 
 
  Fly   356 AFFNANPNFKW--------------YKLPAP------PLRTLATRPSNASAGLLIPSEDQPQQQV 400 
            .....:|::|:              |..|.|      ||:. |..|..||.|||...|....... 
Human    67 QHMKEHPDYKYRPRRKPKNLLKKDRYVFPLPYLGDTDPLKA-AGLPVGASDGLLSAPEKARAFLP 130 
 
  Fly   401 PTSLQVQWAERGEMPRAMLRPNYFKLADETQMGELSSLL 439 
            |.|          .|.::|.|..|..:...:|||:...| 
Human   131 PAS----------APYSLLDPAQFSSSAIQKMGEVPHTL 159 
 
       | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | 
            Simple Score | 
            Weighted Score | 
            Original Tool Information | 
          
          
            | BLAST Result | 
            Score | 
            Score Type | 
            Cluster ID | 
          
          
          
            | Compara | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Domainoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | eggNOG | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Hieranoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Homologene | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Inparanoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Isobase | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OMA | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OrthoDB | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OrthoFinder | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OrthoInspector | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | orthoMCL | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Panther | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Phylome | 
            1 | 
            0.910 | 
            - | 
            - | 
             | 
             | 
          
          
            | RoundUp | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | SonicParanoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | SwiftOrtho | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | TreeFam | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | User_Submission | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
             | 
            1 | 0.910 | 
             | 
          
        
      
           
             Return to query results.
             Submit another query.