DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bbx and HMGB3

DIOPT Version :9

Sequence 1:NP_001027087.1 Gene:bbx / 3772670 FlyBaseID:FBgn0024251 Length:769 Species:Drosophila melanogaster
Sequence 2:NP_001031075.1 Gene:HMGB3 / 838659 AraportID:AT1G20696 Length:147 Species:Arabidopsis thaliana


Alignment Length:91 Identity:24/91 - (26%)
Similarity:40/91 - (43%) Gaps:8/91 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   278 EPRQLQQDETADNTRPEHHARRPMNAFLIFCKRHRGIVKERY-KTLENRAITKILGDWWAALDEQ 341
            :|.:..:....|..:|    :||.:||.:|.:..|...||.: |.....|:.|..|:.|.:|.:.
plant    20 KPAKGAKGAAKDPNKP----KRPSSAFFVFMEDFRVTYKEEHPKNKSVAAVGKAGGEKWKSLSDS 80

  Fly   342 EKHCFTDLAQQNKDAFFNANPNFKWY 367
            ||..:...|.:.|..:   ..|.|.|
plant    81 EKAPYVAKADKRKVEY---EKNMKAY 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bbxNP_001027087.1 SOX-TCF_HMG-box 296..367 CDD:238684 20/71 (28%)
HMGB3NP_001031075.1 HMGB-UBF_HMG-box 35..101 CDD:238686 20/72 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.