powered by:
Protein Alignment bbx and Hbp1
DIOPT Version :9
| Sequence 1: | NP_001027087.1 |
Gene: | bbx / 3772670 |
FlyBaseID: | FBgn0024251 |
Length: | 769 |
Species: | Drosophila melanogaster |
| Sequence 2: | XP_006515290.1 |
Gene: | Hbp1 / 73389 |
MGIID: | 894659 |
Length: | 570 |
Species: | Mus musculus |
| Alignment Length: | 81 |
Identity: | 29/81 - (35%) |
| Similarity: | 45/81 - (55%) |
Gaps: | 9/81 - (11%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 287 TADNTRPEHHARRPMNAFLIFCKRHRGIVKERYKTLENRAITKILGDWWAALDEQEKHCFT---- 347
|...|.| :..:||||||::|.|::|....:.|...:||||:.||||.|..:..:|:..:|
Mouse 437 TVSATSP-NKCKRPMNAFMLFAKKYRVEYTQMYPGKDNRAISVILGDRWKKMKNEERRMYTLEAK 500
Fly 348 DLAQQNKDAFFNANPN 363
.||::.| ..||:
Mouse 501 ALAEEQK----RLNPD 512
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG2746 |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.