DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: bbx and Cic

Sequence 1:NP_001027087.1 Gene:bbx FlyBaseID:FBgn0024251 Length:769 Species:Drosophila melanogaster
Sequence 2:XP_011248998.1 Gene:Cic MGIID:1918972 Length:2512 Species:Mus musculus

Alignment Length:763 Identity:181/764 (24%)
Similarity:263/764 (34%) Gaps:255/764 (33%)


  Fly   143 PISRTKDKPSSAGEAEAKTLVREGESQGS--------PGKVAKSALGDPQPQRTEDQENAFRRIE 199
            |.|.......|...||:..:..|....|:        ||.|...:.| |.|..|         :.
Mouse   968 PASHPVASNQSKEPAESAAVAHEQPPGGTGGADPGRPPGAVCPESPG-PGPPLT---------LG 1022

  Fly   200 DVHNYAKLQDCSSDTDDEDDEEEDLDEE-EDDEEEA-------EIQVQLPVQQEVTRIRREAAEE 256
            .|.....|...:.:.......|..||.| |.|.::|       |||:.||..:..|:        
Mouse  1023 GVDPGKSLPPTTEEEAPGPPGEPRLDSETESDHDDAFLSIMSPEIQLPLPPGKRRTQ-------- 1079

  Fly   257 HVDVDVVTVPQQEQDQYSHQVEPRQLQQDETADNTRPEHHARRPMNAFLIFCKRHRGIVKERYKT 321
                .:..:| :|:|..|        ::|..:.|.|.:.|.|||||||:||.||||.:|.:|:..
Mouse  1080 ----SLSALP-KERDSSS--------EKDGRSPNKREKDHIRRPMNAFMIFSKRHRALVHQRHPN 1131

  Fly   322 LENRAITKILGDWWAALDEQEKHCFTDLAQQNKDAFFNANPNFKW-------YKLPAPPL----- 374
            .:||.::||||:||.||..:||..:.|||.|.|:|.|.|:|::||       ....|.|.     
Mouse  1132 QDNRTVSKILGEWWYALGPKEKQKYHDLAFQVKEAHFKAHPDWKWCNKDRKKSSSEAKPASLGLA 1196

  Fly   375 --------RTLATRPSNASAGL-----------LIPSEDQPQQQVPTS-------LQVQWAERGE 413
                    |:::...:.|:.|:           |:.|:    .:||.|       |....|....
Mouse  1197 GGHKETRERSMSETGTAAAPGVSSELLSVAAQTLLSSD----TKVPGSGPCGAERLHAVGAPGSA 1257

  Fly   414 MPRAMLRPNYFKLADETQMGELSSLLQVQVQEKDFALQQVLSETSQFLSAHMPAGNTNGNGNKRS 478
            .|||........|    ..||:.|              |.|.|.:|.:|     |..:.:|.|.|
Mouse  1258 RPRAFSHSGVHSL----DGGEVDS--------------QALQELTQMVS-----GPASYSGPKPS 1299

  Fly   479 LQ-DNNSSNSSEEE----AASGSSPNKKVKSSRS-----------------CKGKIYQELV--NS 519
            .| ....|.::..|    |.||..|....::|||                 |:.:...:::  :|
Mouse  1300 PQYGAPGSFAAPGEGGTLATSGRPPLLPSRASRSQRAASEDMTSDEERMVICEEEGDDDVIADDS 1364

  Fly   520 GQLAAIAKKSKARL-----------PPAGNMG-GNFVDIP------------LD---AGPNTPPV 557
            .....|..|.|.|:           .|.||.| |..|..|            ||   .||..||.
Mouse  1365 FGTTDIDLKCKERVTDSESGDSSGEDPEGNKGFGRKVFSPVIRSSFTHCRPTLDPEPPGPPDPPA 1429

  Fly   558 S------PPERQGSSPDSMQKHIRSVSESSSSGFFDLEEKIKELPALSL-------DAYLQRKRS 609
            :      |.....|||.|....: |.|.|..||.|..:|..:...|:.|       .......::
Mouse  1430 AFSKGYGPTPSSSSSPASTSVSV-STSFSLGSGTFKTQESGQGSTAVPLRPPPPGAGGPATPSKA 1493

  Fly   610 TKKKKKFSGTKKQRNSNSTSGASATS-NVAAADAAAKG------AVPLSSEQHVRIKQQQLQAVG 667
            |:.....|.|.:::...|.....|.. :|.||..:..|      .:|.|.|              
Mouse  1494 TRFPPTDSATFRRKRPESVGSLEAPGPSVIAAPPSGGGNLLQTLVLPPSKE-------------- 1544

  Fly   668 SQRRKARKESITRRDVSAIEQEVASILPLTINGSYYFNQSGAPKA------------VNAPVTSS 720
             .|...|..|             |...||..         |||.|            |..||:|:
Mouse  1545 -DREGTRVPS-------------APAPPLAY---------GAPAAPLCRPAATMVTNVVRPVSST 1586

  Fly   721 S---ASPPLSSNSSSSSSSLSSQAAFDVTSSTSDLLILAEVAANRTEL 765
            .   ||.|..::..:.:||                   .::|..|||:
Mouse  1587 PVPIASKPFPTSGRAEASS-------------------NDIAGARTEM 1615

Known Domains:


GeneSequenceDomainRegion External IDIdentity
bbxNP_001027087.1 SOX-TCF_HMG-box 296..367 CDD:238684 39/78 (50%)
CicXP_011248998.1 DUF4819 253..342 CDD:292708
NHP6B 1063..1222 CDD:227935 57/180 (32%)
SOX-TCF_HMG-box 1106..1177 CDD:238684 39/71 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2746
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.