| Sequence 1: | NP_001027087.1 | Gene: | bbx / 3772670 | FlyBaseID: | FBgn0024251 | Length: | 769 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_011248998.1 | Gene: | Cic / 71722 | MGIID: | 1918972 | Length: | 2512 | Species: | Mus musculus |
| Alignment Length: | 763 | Identity: | 181/763 - (23%) |
|---|---|---|---|
| Similarity: | 263/763 - (34%) | Gaps: | 255/763 - (33%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 143 PISRTKDKPSSAGEAEAKTLVREGESQGS--------PGKVAKSALGDPQPQRTEDQENAFRRIE 199
Fly 200 DVHNYAKLQDCSSDTDDEDDEEEDLDEE-EDDEEEA-------EIQVQLPVQQEVTRIRREAAEE 256
Fly 257 HVDVDVVTVPQQEQDQYSHQVEPRQLQQDETADNTRPEHHARRPMNAFLIFCKRHRGIVKERYKT 321
Fly 322 LENRAITKILGDWWAALDEQEKHCFTDLAQQNKDAFFNANPNFKW-------YKLPAPPL----- 374
Fly 375 --------RTLATRPSNASAGL-----------LIPSEDQPQQQVPTS-------LQVQWAERGE 413
Fly 414 MPRAMLRPNYFKLADETQMGELSSLLQVQVQEKDFALQQVLSETSQFLSAHMPAGNTNGNGNKRS 478
Fly 479 LQ-DNNSSNSSEEE----AASGSSPNKKVKSSRS-----------------CKGKIYQELV--NS 519
Fly 520 GQLAAIAKKSKARL-----------PPAGNMG-GNFVDIP------------LD---AGPNTPPV 557
Fly 558 S------PPERQGSSPDSMQKHIRSVSESSSSGFFDLEEKIKELPALSL-------DAYLQRKRS 609
Fly 610 TKKKKKFSGTKKQRNSNSTSGASATS-NVAAADAAAKG------AVPLSSEQHVRIKQQQLQAVG 667
Fly 668 SQRRKARKESITRRDVSAIEQEVASILPLTINGSYYFNQSGAPKA------------VNAPVTSS 720
Fly 721 S---ASPPLSSNSSSSSSSLSSQAAFDVTSSTSDLLILAEVAANRTEL 765 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| bbx | NP_001027087.1 | SOX-TCF_HMG-box | 296..367 | CDD:238684 | 39/77 (51%) |
| Cic | XP_011248998.1 | DUF4819 | 253..342 | CDD:406485 | |
| PHA03247 | <647..1061 | CDD:223021 | 23/102 (23%) | ||
| NHP6B | 1063..1222 | CDD:227935 | 57/179 (32%) | ||
| SOX-TCF_HMG-box | 1106..1177 | CDD:238684 | 38/70 (54%) | ||
| PHA03247 | <1671..2172 | CDD:223021 | |||
| PHA03247 | <1979..2464 | CDD:223021 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG2746 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.900 | |||||