DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: bbx and Bbx

Sequence 1:NP_001027087.1 Gene:bbx FlyBaseID:FBgn0024251 Length:769 Species:Drosophila melanogaster
Sequence 2:XP_006522606.1 Gene:Bbx MGIID:1917758 Length:937 Species:Mus musculus

Alignment Length:643 Identity:157/644 (24%)
Similarity:244/644 (38%) Gaps:194/644 (30%)


  Fly   206 KLQDCSSDTDDEDDEEEDLDEEEDDEEEAEIQVQLPVQQEVTRIRREAAEEHVDVDVVTVPQQEQ 270
            ||.|.|.: ::||:||||:|           :|||                              
Mouse    35 KLLDFSEE-EEEDEEEEDID-----------KVQL------------------------------ 57

  Fly   271 DQYSHQVEPRQLQQD--ETADNTRPEHHARRPMNAFLIFCKRHRGIVKERYKTLENRAITKILGD 333
                  :|...|:||  ||.|:..||..|||||||||:||||||.:|::.:..|:||..||||.|
Mouse    58 ------LEADGLEQDVAETEDDESPEQRARRPMNAFLLFCKRHRSLVRQEHPRLDNRGATKILAD 116

  Fly   334 WWAALDEQEKHCFTDLAQQNKDAFFNANPNFKW-------YKLPAP---PLRTLATRPSNASAGL 388
            |||.||.:||..:||:|::.||||..|||.::|       .|.|.|   |.:.|...|.::|..|
Mouse   117 WWAVLDPKEKQKYTDMAKEYKDAFMKANPGYRWCPTTNKPVKSPTPTVNPRKKLWAFPPDSSRDL 181

  Fly   389 LIPSEDQPQQQVPTSLQVQWAERGEMPRAMLRPNYFKLADETQMGELSSLL-------------- 439
              |:..:.:.:||   |:.                |.:||.||||.||.||              
Mouse   182 --PTPKKAKTEVP---QLN----------------FGMADPTQMGGLSMLLLAGEHALGTPEASS 225

  Fly   440 ---------QVQVQEKD--FALQQVLSETSQ-------------FLSAHMPAGNTNGNGNKRSLQ 480
                     ..::::|.  |...::.|.||.             |..|.:.:..:...|.:...:
Mouse   226 GTCRPDISESPELRQKSPLFQFAEISSRTSHPDAPSKQCQASALFQFAEISSSTSQLGGTEPVKR 290

  Fly   481 DNNSSNSSEEEAASGS-----SPNKKVKSSRSCKGKIYQELVNSG-----------------QLA 523
            ..||:.....|....|     ...|.:||..|..|:|  |.:..|                 :.|
Mouse   291 CGNSALFQLAEMCLASEGVKMEDTKLIKSKESDGGRI--EEIEKGKEERGTEVEKTTETSFQKEA 353

  Fly   524 AIAKKSKARLPPAGNMGGNFVDIPLDAGPNTPPVSPPERQGSSPDSMQK--HIRSVSESSSSGFF 586
            ...|.:|..:..:.:: .:...:.:| ......|..|:.....|:..||  |....|.|:||...
Mouse   354 EFGKSAKGNVRESKDL-RDIEQLQMD-NVMAIKVEDPKEIRKEPEDDQKYSHFPDFSYSASSKII 416

  Fly   587 DLEEKIKELPA-------------LSLDAYLQRKRSTKKKKKFSGTKKQRNSNST---------- 628
                 |..:|:             :.....|.:....|||||.:...:..|..||          
Mouse   417 -----ISGVPSRKDHMCHPHGIMIIEDPTTLNKPEKIKKKKKKNKLDRHGNDKSTPKKTCKKRQS 476

  Fly   629 SGASATSNVAAADAAAKGAVPLSSEQHVRIKQQQLQAVG----------SQRRKARKESITRRDV 683
            |.:...|.:...:|.|||...:........|:.:..:.|          .::.|::::.:::...
Mouse   477 SESDIESVMYTIEAVAKGDWGVDKLGETPRKKVRPSSSGKGGILDAKPPKKKVKSKEKKVSKEKC 541

  Fly   684 SAIEQEVASILPLTINGSYYFNQSGAPKAVNAPVTSSSASPPLSSNSSSSSSSLSSQA 741
            |.|.:|......|:|:.|         |:|...|.....:.||:....:...||..||
Mouse   542 SDITKESRPPDFLSISAS---------KSVPGEVPEGIKAEPLTPTEDALPPSLPGQA 590

Known Domains:


GeneSequenceDomainRegion External IDIdentity
bbxNP_001027087.1 SOX-TCF_HMG-box 296..367 CDD:238684 42/78 (54%)
BbxXP_006522606.1 SOX-TCF_HMG-box 79..150 CDD:238684 42/71 (59%)
DUF2028 190..301 CDD:286715 24/130 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C366243900
eggNOG 1 0.900 E1_KOG2746
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 171 1.000 Inparanoid score I4082
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005462
OrthoInspector 1 1.000 T1082553
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR13059
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R8059
TreeFam 00.000 Not matched by this tool.
77.010

Return to query results.
Submit another query.