DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment bbx and SOX15

DIOPT Version :9

Sequence 1:	NP_001027087.1	Gene:	bbx / 3772670	FlyBaseID:	FBgn0024251	Length:	769	Species:	Drosophila melanogaster
Sequence 2:	NP_008873.1	Gene:	SOX15 / 6665	HGNCID:	11196	Length:	233	Species:	Homo sapiens

Alignment Length:	140	Identity:	36/140 - (25%)
Similarity:	59/140 - (42%)	Gaps:	18/140 - (12%)

- Green bases have known domain annotations that are detailed below.

  Fly   263 VTVPQQEQDQYSHQVEP---------------RQLQQDETADNTRPEHHARRPMNAFLIFCKRHR 312
            :.:|...||| :..:||               |:......|..|.|....:||||||:::....|
Human     1 MALPGSSQDQ-AWSLEPPAATAAASSSSGPQEREGAGSPAAPGTLPLEKVKRPMNAFMVWSSAQR 64

  Fly   313 GIVKERYKTLENRAITKILGDWWAALDEQEKHCFTDLAQQNKDAFFNANPNFKWYKLPAPPLRTL 377
            ..:.::...:.|..|:|.||..|..|||.||..|.:.|::.:.......|::|:  .|....::.
Human    65 RQMAQQNPKMHNSEISKRLGAQWKLLDEDEKRPFVEEAKRLRARHLRDYPDYKY--RPRRKAKSS 127

  Fly   378 ATRPSNASAG 387
            ...||....|
Human   128 GAGPSRCGQG 137

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
bbx	NP_001027087.1	SOX-TCF_HMG-box	296..367	CDD:238684	22/70 (31%)
SOX15	NP_008873.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..48		10/47 (21%)
		Required to promote HAND1 transcriptional activator activity. /evidence=ECO:0000250\|UniProtKB:P43267	1..47		10/46 (22%)
		SOX-TCF_HMG-box	48..119	CDD:238684	22/72 (31%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	113..153		6/27 (22%)
		Interaction with FHL3. /evidence=ECO:0000250\|UniProtKB:P43267	138..183		36/140 (26%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	208..233
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910