DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: bbx and BBX

Sequence 1:NP_001027087.1 Gene:bbx FlyBaseID:FBgn0024251 Length:769 Species:Drosophila melanogaster
Sequence 2:XP_024309412.1 Gene:BBX HGNCID:14422 Length:953 Species:Homo sapiens

Alignment Length:649 Identity:171/650 (26%)
Similarity:251/650 (39%) Gaps:204/650 (31%)


  Fly   206 KLQDCSSDTDDEDDEEEDLDEEEDDEEEAEIQVQLPVQQEVTRIRREAAEEHVDVDVVTVPQQEQ 270
            ||.|.|.: ::|:|||||:|           :|||                 :..|         
Human    47 KLLDFSEE-EEEEDEEEDID-----------KVQL-----------------LGAD--------- 73

  Fly   271 DQYSHQVEPRQLQQD--ETADNTRPEHHARRPMNAFLIFCKRHRGIVKERYKTLENRAITKILGD 333
                      .|:||  ||.|:..||..|||||||||:||||||.:|::.:..|:||..||||.|
Human    74 ----------GLEQDVGETEDDESPEQRARRPMNAFLLFCKRHRSLVRQEHPRLDNRGATKILAD 128

  Fly   334 WWAALDEQEKHCFTDLAQQNKDAFFNANPNFKW-------YKLPAP---PLRTLATRPSNASAGL 388
            |||.||.:||..:||:|::.||||..|||.:||       .|.|.|   |.:.|...||::|..|
Human   129 WWAVLDPKEKQKYTDMAKEYKDAFMKANPGYKWCPTTNKPVKSPTPTVNPRKKLWAFPSDSSRDL 193

  Fly   389 LIPSEDQPQQQVPTSLQVQWAERGEMPRAMLRPNYFKLADETQMGELSSLLQVQVQEKDFALQQV 453
            ..|.:               |:..|||:.     .|.:||.||||.||.||  ...|......:|
Human   194 PSPKK---------------AKTEEMPQL-----NFGMADPTQMGGLSMLL--LAGEHALGTPEV 236

  Fly   454 LSETSQ---------------FLSAHMPAGNTNGNGNKRSLQDNN-------SSNSSEEEAASGS 496
            .|.|.:               |..|.:.:..::.:.:.:..|.:.       |||:|:   ..|:
Human   237 SSGTCRPDVSESPELRQKSPLFQFAEISSSTSHSDASTKQCQTSALFQFAEISSNTSQ---LGGA 298

  Fly   497 SPNK--------------------KVKSSRSCKGK------------------IYQELVNSGQL- 522
            .|.|                    |::.|:..|.|                  |..|..:..:| 
Human   299 EPVKRCGKSALFQLAEMCLASEGMKMEESKLIKAKESDGGRIKELEKGKEEKEIKMEKTDETRLQ 363

  Fly   523 --AAIAKKSKARLPPAGNMGGNFVDIPLDAGPNTPPVSPPE--RQGSSPDSMQKHIRSVSESSSS 583
              |...|.:|..|..:..: .||..:.:|.........|.|  ::....|....|....|.|:||
Human   364 KEAEFEKSAKENLRDSKEL-RNFEALQIDDIMAIKMEDPKEIRKEELEEDHKCSHFPDFSYSASS 427

  Fly   584 GFFDLEEKIKELPA-------------LSLDAYLQRKRSTKKKKKFSGTKKQRNSNST------- 628
            ...     |.::|:             :...|.|.:....|||||.|...:..|..||       
Human   428 KII-----ISDVPSRKDHMCHPHGIMIIEDPAALNKPEKLKKKKKKSKMDRHGNDKSTPKKTCKK 487

  Fly   629 ---SGASATSNVAAADAAAKGAVPLSSEQHVRIKQQQLQAVG----------SQRRKARKESITR 680
               |.:...|.:...:|.|||...:........|:.:..:.|          .::.|:|::.:::
Human   488 RQSSESDIESVIYTIEAVAKGDWGIEKLGDTPRKKVRTSSSGKGSILDAKPPKKKVKSREKKMSK 552

  Fly   681 RDVSAIEQEVASILPLTINGSYYFNQSG-APKAVNA-PVT-SSSASPPLSSNSSSSSSSLSSQA 741
            ...|...:|  |..|..|:.|...|.|| .|:.:.| |:| ...|.||          |||.||
Human   553 EKSSDTTKE--SRPPDFISISASKNISGETPEGIKAEPLTPMEDALPP----------SLSGQA 604

Known Domains:


GeneSequenceDomainRegion External IDIdentity
bbxNP_001027087.1 SOX-TCF_HMG-box 296..367 CDD:238684 43/78 (55%)
BBXXP_024309412.1 SOX-TCF_HMG-box 91..162 CDD:238684 43/71 (61%)
DUF2028 203..>335 CDD:312980 32/142 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C366244566
eggNOG 1 0.900 E1_KOG2746
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I4185
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005462
OrthoInspector 1 1.000 T1072487
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR13059
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R8059
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
77.010

Return to query results.
Submit another query.