DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bbx and AgaP_AGAP012928

DIOPT Version :9

Sequence 1:NP_001027087.1 Gene:bbx / 3772670 FlyBaseID:FBgn0024251 Length:769 Species:Drosophila melanogaster
Sequence 2:XP_001687785.1 Gene:AgaP_AGAP012928 / 5668414 VectorBaseID:AGAP012928 Length:160 Species:Anopheles gambiae


Alignment Length:195 Identity:44/195 - (22%)
Similarity:65/195 - (33%) Gaps:64/195 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   371 APPLRTLATRPSNASAGLLIPSEDQPQQQ---VPTSLQVQWAERG-------EMPRAMLRPNYFK 425
            ||||.:.||..|:...|......|...:|   |.|.     |..|       ..||....|:...
Mosquito     8 APPLSSTATPSSSYVIGNRFFGPDFNMEQYKAVGTG-----AGMGGGPGVDDRSPRTPKTPSQRS 67

  Fly   426 LADETQMGELSSLLQVQVQEKDFALQQVLSETSQFLSAHMPAGNTNGNGNKRSLQDNNSSNSSEE 490
            :....:.|....|     :::...:.|:.:|...|.|.|                    :.:|.:
Mosquito    68 VNSAEEKGHRKIL-----EQRRNLVVQLFNEHGMFPSTH--------------------ATNSFQ 107

  Fly   491 EAASGSSPNKKVKSSRSCKGKIYQELVNSGQLAAIAKKSKARLPPAGNMGGNFVDIPLDAGPNTP 555
            .|.|...|||     :|.:.||.:          :.:||.|:.|       .|.  |..|||.||
Mosquito   108 LAHSDIFPNK-----QSLQLKIRE----------VRQKSMAQQP-------GFT--PQSAGPITP 148

  Fly   556  555
            Mosquito   149  148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bbxNP_001027087.1 SOX-TCF_HMG-box 296..367 CDD:238684
AgaP_AGAP012928XP_001687785.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2746
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.