DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bbx and LEF1

DIOPT Version :9

Sequence 1:NP_001027087.1 Gene:bbx / 3772670 FlyBaseID:FBgn0024251 Length:769 Species:Drosophila melanogaster
Sequence 2:XP_005263103.1 Gene:LEF1 / 51176 HGNCID:6551 Length:414 Species:Homo sapiens


Alignment Length:118 Identity:34/118 - (28%)
Similarity:59/118 - (50%) Gaps:19/118 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 RIRREAAEEHVDVDVVTV-PQQEQDQYSHQVEPRQLQQDETADNTRPEHHARRPMNAFLIFCKRH 311
            ::::|  ..|.|.|::.| ||.||.:   :.||:           ||  |.::|:|||:::.|..
Human   267 QVKQE--HPHTDSDLMHVKPQHEQRK---EQEPK-----------RP--HIKKPLNAFMLYMKEM 313

  Fly   312 RGIVKERYKTLENRAITKILGDWWAALDEQEKHCFTDLAQQNKDAFFNANPNF 364
            |..|.......|:.||.:|||..|.||..:|:..:.:||::.:.......|.:
Human   314 RANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGW 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bbxNP_001027087.1 SOX-TCF_HMG-box 296..367 CDD:238684 21/69 (30%)
LEF1XP_005263103.1 CTNNB1_binding 1..213 CDD:285538
SOX-TCF_HMG-box 298..369 CDD:238684 21/69 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.