DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: bbx and hbp1

Sequence 1:NP_001027087.1 Gene:bbx FlyBaseID:FBgn0024251 Length:769 Species:Drosophila melanogaster
Sequence 2:NP_001008149.2 Gene:hbp1 XenbaseID:XB-GENE-950343 Length:541 Species:Xenopus tropicalis

Alignment Length:144 Identity:40/145 (28%)
Similarity:65/145 (45%) Gaps:32/145 (22%)


  Fly   242 VQQEVTRIRREAAEEHVDVDVVTVPQQEQDQY-SHQVEPRQLQQ------DETADN--------- 290
            |...:.|.||.::...     .:.|:.|:.:| .....||..|.      ::|..|         
 Frog   394 VLSSMARQRRASSNGR-----ASSPESERSEYCKDYASPRSSQTSCSSLCNKTGRNHTSGTANSV 453

  Fly   291 --TRPEHHARRPMNAFLIFCKRHRGIVKERYKTLENRAITKILGDWWAALDEQEKHCFT----DL 349
              |.| :..:||||||::|.|::|....:.|...:||||:.||||.|..:..:|:..:|    .|
 Frog   454 PVTSP-NKCKRPMNAFMLFAKKYRVEYTQMYPGKDNRAISVILGDRWKKMKNEERRIYTIEAKAL 517

  Fly   350 AQQNKDAFFNANPN 363
            |::.|    ..||:
 Frog   518 AEEQK----RLNPD 527

Known Domains:


GeneSequenceDomainRegion External IDIdentity
bbxNP_001027087.1 SOX-TCF_HMG-box 296..367 CDD:238684 26/73 (36%)
hbp1NP_001008149.2 AXH 241..365 CDD:304566
SOX-TCF_HMG-box 460..531 CDD:238684 26/73 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2746
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.