DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: bbx and sox21b

Sequence 1:NP_001027087.1 Gene:bbx FlyBaseID:FBgn0024251 Length:769 Species:Drosophila melanogaster
Sequence 2:NP_001009888.1 Gene:sox21b ZFINID:ZDB-GENE-040429-1 Length:245 Species:Danio rerio

Alignment Length:280 Identity:53/281 (19%)
Similarity:93/281 (33%) Gaps:113/281 (40%)


  Fly   291 TRPEHHARRPMNAFLIFCKRHRGIVKERYKTLENRAITKILGDWWAALDEQEKHCFTDLAQQNKD 355
            ::|..|.:||||||:::.:..|..:.:....:.|..|:|.||..|..|.|.||..|.|.|::.:.
Zfish     2 SKPMDHVKRPMNAFMVWSRAQRRKMAQENPKMHNSEISKRLGAEWKLLTESEKRPFIDEAKRLRA 66

  Fly   356 AFFNANPNFKWYKLPAPPLRTLATRPSNASAGLLIPSEDQPQQQVPTSLQVQWAERGEMPRAMLR 420
            .....:|::|:                            :|:::               |:.:::
Zfish    67 MHMKEHPDYKY----------------------------RPRRK---------------PKTLMK 88

  Fly   421 PNYFKLADETQMGELSSLLQVQVQEKDFALQQVLSETSQFLSAHMPAGNTNGNGNKRSLQDNNSS 485
            .:.|.......:||..:|                      ....:|||         :|.::..|
Zfish    89 KDKFAFPVAYNLGEHEAL----------------------KVGGLPAG---------ALTESLMS 122

  Fly   486 NSSEEEAASGSSPNKKVKSSRSCKGKIYQELVNSGQLAAIAKKSKARLPPAGNMGGN---FVDIP 547
            |           |:|                     .||.|..:.||:....:|..|   |.|: 
Zfish   123 N-----------PDK---------------------AAAAAAAAAARVFFNPSMSANPYSFFDL- 154

  Fly   548 LDAGPNTPPVSPPERQGSSP 567
               |.....:|||....:||
Zfish   155 ---GSKMTELSPPSFSYASP 171

Known Domains:


GeneSequenceDomainRegion External IDIdentity
bbxNP_001027087.1 SOX-TCF_HMG-box 296..367 CDD:238684 23/71 (32%)
sox21bNP_001009888.1 SOX-TCF_HMG-box 7..78 CDD:238684 23/99 (23%)
SOXp 77..>95 CDD:289133 3/61 (5%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.