DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: bbx and cicb

Sequence 1:NP_001027087.1 Gene:bbx FlyBaseID:FBgn0024251 Length:769 Species:Drosophila melanogaster
Sequence 2:XP_005173569.1 Gene:cicb ZFINID:ZDB-GENE-030131-1966 Length:2632 Species:Danio rerio

Alignment Length:864 Identity:194/865 (22%)
Similarity:306/865 (35%) Gaps:239/865 (28%)


  Fly     2 INGLSVGGGQQVAQVTPTGAAIKLHFAYNNNSNNSSSSNISNSNYSGLKTSETKMRNNKNYTGRA 66
            ||..|..|  .|....||...:.:          |::|:|.|.|.:||.|..:.       |...
Zfish  1139 INAASTNG--SVLLQNPTSTLVLV----------STTSSIPNPNPAGLPTQPSA-------TLAC 1184

  Fly    67 LKIVEKIPGASGVIATTSGNQGARSLEG-------YSPAAASYVSGL----------SRDFLISR 114
            :.:...:.|| |:|....|....:|...       ..||..:.:..:          .:|.::. 
Zfish  1185 ISVPSPVSGA-GLIGAGDGGGQDKSCPATLQQPVPCHPAPTALLPLILPTETLHPVPCKDIIMG- 1247

  Fly   115 ELSQRSGEFLTAAAKMVSQMGASELRWLPI----------SRTKDKPSS-AGEAE-----AKTLV 163
                |.|...|..          |.|.:|:          :.|:..||: .||.:     .:|..
Zfish  1248 ----RPGTVWTNV----------EPRSVPVFPWHSLVPFLAPTQSDPSAQPGEGQQTVSHPQTAA 1298

  Fly   164 REGESQGSPGKVAKSAL-GDPQPQRTEDQENAFRRIEDVHNYAKLQDCSSDTDDED----DEEED 223
            .:.|||.  |.|.|..: |.|.|.                        |..|...|    :.|:|
Zfish  1299 LKKESQS--GSVLKEIIEGAPNPS------------------------SRPTPSADELPPEREKD 1337

  Fly   224 LDEEEDDEEEAEIQVQLPVQQEVTRIRREAAEEHVDVDVVTVPQQEQDQYSHQVEPRQLQQDETA 288
            .:.|..| .|.|..|..|....|.          .|..:...|.:.:.| |....|:   .|:.:
Zfish  1338 AERERPD-SETESDVDDPFFPGVL----------PDPPISASPGKRRSQ-SLSALPK---DDKNS 1387

  Fly   289 DNTRPEHHARRPMNAFLIFCKRHRGIVKERYKTLENRAITKILGDWWAALDEQEKHCFTDLAQQN 353
            ...|.:.|.|||||||:||.||||.:|.:|:...:||.::||||:||.||..:||..:.|||.|.
Zfish  1388 PGKREKDHIRRPMNAFMIFSKRHRALVHQRHPNQDNRTVSKILGEWWYALGPKEKQKYHDLAFQV 1452

  Fly   354 KDAFFNANPNFKWYKLPAPPLRTLATRPSNASAGLLIP----------SEDQPQQQVPTSLQ--- 405
            |:|.|.|:|::||..         ..|..::|.|..:|          ||......|...::   
Zfish  1453 KEAHFKAHPDWKWCN---------KDRKKSSSEGRGVPGGKDIRERSMSETTEPPSVSMGMELKG 1508

  Fly   406 -----VQWAER--GEMPRAMLRPNYFKLA-----DETQMGE---LSSLLQVQVQEKDFALQQVLS 455
                 |..:||  ||....:.||..|..:     :.::.|.   |:.|.|:.........:..||
Zfish  1509 MGPGMVSVSERVGGEGHGQLTRPRAFSQSAMHSLERSERGNPQALAELAQMCGDGSQVGGRGALS 1573

  Fly   456 ETSQFLSAHMPAGN-----TNGNGNKRSLQDNNSSNS-----------SEEEAASGSSPNKKVKS 504
            :|.:.:|..|.:.:     ....|:...::|:...:|           |:.|..||....:|   
Zfish  1574 QTQRGVSEDMTSDDERMVICEEEGDDDVIEDSYPGSSIDLKCKERVTDSDSENGSGDEGERK--- 1635

  Fly   505 SRSCKGKIYQELVNS-------GQLAAIAKKSKARLPPAGNMGGNFVDI------PLDAGPNTPP 556
                  :::..::.|       |:..:::....:|         .|.|.      .::||..   
Zfish  1636 ------RVFAPVICSSSYGPGHGRSVSLSSYPTSR---------RFSDTSSKRKRTIEAGDG--- 1682

  Fly   557 VSPPERQGSSPDSMQKHIRSVSESSSSGFFDLEEKIKEL---------PALSLDAYLQRKRSTKK 612
               .:|:|....|.....:|:..||..|...:...::..         |.:|....:..|....:
Zfish  1683 ---EQREGEGGASQPSAGQSILVSSGGGVSSMLGAVRVASTVVTNVVRPVVSTPVPIASKSPHDR 1744

  Fly   613 KKKFSGTKKQRNSNSTSGASATSNVAAADAAAKGAVPLSSEQHVRIKQQQLQAV------GSQRR 671
            |...|.|:      ...|..||.|.|||.|...|....||...:.....|...|      |:.:.
Zfish  1745 KLAPSQTQ------LLIGHGATGNTAAASAGGGGYYSSSSPSPINAPAGQAGLVTNLVLGGTFQA 1803

  Fly   672 KARKESITRRDVSAIEQEVAS------ILPLTINGSYYF-NQSGAPKAVNAPVTS-SSASPPLSS 728
            ....:.:|....|   |..||      .|||.:..|:.. :.|.||.:...|:|. ....|.||:
Zfish  1804 PPAVQLVTPPPPS---QNPASPAHSNGPLPLPVLQSHILPSGSLAPSSGQKPITQVQYILPTLSA 1865

  Fly   729 NSSSSSSSLSSQAAFDVTS 747
            |:..|.   |.|.|...||
Zfish  1866 NNPKSP---SPQQASQPTS 1881

Known Domains:


GeneSequenceDomainRegion External IDIdentity
bbxNP_001027087.1 SOX-TCF_HMG-box 296..367 CDD:238684 39/71 (55%)
cicbXP_005173569.1 DUF4819 449..538 CDD:292708
SOX-TCF_HMG-box 1395..1466 CDD:238684 39/71 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2746
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.