DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bbx and HBP1

DIOPT Version :10

Sequence 1:NP_001027087.1 Gene:bbx / 3772670 FlyBaseID:FBgn0024251 Length:769 Species:Drosophila melanogaster
Sequence 2:NP_001231191.1 Gene:HBP1 / 26959 HGNCID:23200 Length:524 Species:Homo sapiens


Alignment Length:81 Identity:29/81 - (35%)
Similarity:45/81 - (55%) Gaps:9/81 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 TADNTRPEHHARRPMNAFLIFCKRHRGIVKERYKTLENRAITKILGDWWAALDEQEKHCFT---- 347
            |...|.| :..:||||||::|.|::|....:.|...:||||:.||||.|..:..:|:..:|    
Human   435 TVSATSP-NKCKRPMNAFMLFAKKYRVEYTQMYPGKDNRAISVILGDRWKKMKNEERRMYTLEAK 498

  Fly   348 DLAQQNKDAFFNANPN 363
            .||::.|    ..||:
Human   499 ALAEEQK----RLNPD 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bbxNP_001027087.1 HMG-box_HBP2 298..366 CDD:438805 26/70 (37%)
HBP1NP_001231191.1 AXH 224..350 CDD:197779
HMG-box_HBP1 445..513 CDD:438804 26/70 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.