DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: bbx and CIC

Sequence 1:NP_001027087.1 Gene:bbx FlyBaseID:FBgn0024251 Length:769 Species:Drosophila melanogaster
Sequence 2:NP_001291744.1 Gene:CIC HGNCID:14214 Length:2517 Species:Homo sapiens

Alignment Length:831 Identity:179/832 (22%)
Similarity:268/832 (32%) Gaps:304/832 (37%)


  Fly    61 NYTGRALKIVEKIPGASGVIATTSGNQGARSL------------------------EGYSPAAAS 101
            :||.......|.|.|..|.:.|   |...||:                        |...||:..
Human   913 SYTSHPAPKKEVIMGRPGTVWT---NVEPRSVAVFPWHSLVPFLAPSQPDPSVQPSEAQQPASHP 974

  Fly   102 YVSGLSRDFLISRELSQRSGEFLTAAAKMVSQMGASELRWLPISRTKDKPSSAGEAEAKTLVREG 166
            ..|..|::...|..::.......|.:|......||:    .|.|.....|...|..|:       
Human   975 VASNQSKEPAESAAVAHERPPGGTGSADPERPPGAT----CPESPGPGPPHPLGVVES------- 1028

  Fly   167 ESQGSPGKVAKSALGDPQPQRTEDQENAFRRIEDVHNYAKLQDCSSDTDDEDDEEEDLDEEEDDE 231
             .:|.|....:.|.|.|...|.:                                   .|.|.|.
Human  1029 -GKGPPPTTEEEASGPPGEPRLD-----------------------------------SETESDH 1057

  Fly   232 EEA-------EIQVQLPVQQEVTRIRREAAEEHVDVDVVTVPQQEQDQYSHQVEPRQLQQDETAD 289
            ::|       |||:.||..:..|:            .:..:| :|:|..|        ::|..:.
Human  1058 DDAFLSIMSPEIQLPLPPGKRRTQ------------SLSALP-KERDSSS--------EKDGRSP 1101

  Fly   290 NTRPEHHARRPMNAFLIFCKRHRGIVKERYKTLENRAITKILGDWWAALDEQEKHCFTDLAQQNK 354
            |.|.:.|.|||||||:||.||||.:|.:|:...:||.::||||:||.||..:||..:.|||.|.|
Human  1102 NKREKDHIRRPMNAFMIFSKRHRALVHQRHPNQDNRTVSKILGEWWYALGPKEKQKYHDLAFQVK 1166

  Fly   355 DAFFNANPNFKWYKLPAPPLRTLATRPSNASAGLLIPSEDQPQQQVPTSLQVQWAERGEMPRAML 419
            :|.|.|:|::||..         ..|..::|            :..||||.:....:....|:| 
Human  1167 EAHFKAHPDWKWCN---------KDRKKSSS------------EAKPTSLGLAGGHKETRERSM- 1209

  Fly   420 RPNYFKLADET----QMGELSSLLQVQVQ------------------------------------ 444
                    .||    ..|..|.||.|..|                                    
Human  1210 --------SETGTAAAPGVSSELLSVAAQTLLSSDTKAPGSSSCGAERLHTVGGPGSARPRAFSH 1266

  Fly   445 ---------EKDFALQQVLSETSQFLSAHMPAGNTNGNGNKRSLQDN-----NSSNSSEEEAASG 495
                     |.|   .|.|.|.:|.:|     |..:.:|.|.|.|..     .:.......||:|
Human  1267 SGVHSLDGGEVD---SQALQELTQMVS-----GPASYSGPKPSTQYGAPGPFAAPGEGGALAATG 1323

  Fly   496 SSPNKKVKSSRSCKGKIYQELVNSGQLAAIAK--------------------KSKARL------- 533
            ..|....::|||.:. ..:::.:..:...|.:                    |.|.|:       
Human  1324 RPPLLPTRASRSQRA-ASEDMTSDEERMVICEEEGDDDVIADDGFGTTDIDLKCKERVTDSESGD 1387

  Fly   534 ----PPAGNMG-----------GNFVDI--PLD---AGPNTPPVSPPERQGSSPDSMQKHIRSVS 578
                .|.||.|           .:|...  |||   .||..|||:..:..||:|.|......|.|
Human  1388 SSGEDPEGNKGFGRKVFSPVIRSSFTHCRPPLDPEPPGPPDPPVAFGKGYGSAPSSSASSPASSS 1452

  Fly   579 ESSSSGFFDLEEKIKELPALSLDAYLQRKRSTKKKKKFSGTKKQRNSNSTSGASATSNVAAADAA 643
            .|:::.|             ||.               |||.|.:.|.  .|::|.........|
Human  1453 ASAATSF-------------SLG---------------SGTFKAQESG--QGSTAGPLRPPPPGA 1487

  Fly   644 AKGAVPLSSEQHVRIKQQQLQAVGSQRRKARKESITRRDVSAIEQEVASILPLTINGSYYFNQS- 707
            ...|.|..:.:.:.:.....       |:.|.||     |..:|....|::....:|.....|: 
Human  1488 GGPATPSKATRFLPMDPATF-------RRKRPES-----VGGLEPPGPSVIAAPPSGGGNILQTL 1540

  Fly   708 -----------GAPKAVNAPVTSSSASPPLSSNSSSSSSSLSSQAAFDVTS 747
                       |..:..:||..|.:...|        ::.||..||..||:
Human  1541 VLPPNKEEQEGGGARVPSAPAPSLAYGAP--------AAPLSRPAATMVTN 1583

Known Domains:


GeneSequenceDomainRegion External IDIdentity
bbxNP_001027087.1 SOX-TCF_HMG-box 296..367 CDD:238684 39/71 (55%)
CICNP_001291744.1 DUF4819 252..349 CDD:292708
NHP6B <1080..1224 CDD:227935 59/195 (30%)
SOX-TCF_HMG-box 1108..1179 CDD:238684 39/71 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2746
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.