DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bbx and sox-4

DIOPT Version :9

Sequence 1:NP_001027087.1 Gene:bbx / 3772670 FlyBaseID:FBgn0024251 Length:769 Species:Drosophila melanogaster
Sequence 2:NP_001335567.1 Gene:sox-4 / 182547 WormBaseID:WBGene00015716 Length:260 Species:Caenorhabditis elegans


Alignment Length:104 Identity:32/104 - (30%)
Similarity:52/104 - (50%) Gaps:16/104 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 DVVTVPQQEQDQYSHQVEPRQLQQDETADNTRPEHHARRPMNAFLIFCKRHRGIVKERYKTLENR 325
            |||...|:...|      ||          |..|...:||||||:::.::.|..:....:...|.
 Worm   101 DVVNSSQKSASQ------PR----------TAREPRIKRPMNAFMVWSQQRRQQIAATGQKFHNS 149

  Fly   326 AITKILGDWWAALDEQEKHCFTDLAQQNKDAFFNANPNF 364
            .|:|:||..|..::|.||..|.:.|:|.::..|||:|::
 Worm   150 DISKMLGAEWRKMEEHEKVPFVERAKQLREEHFNAHPDY 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bbxNP_001027087.1 SOX-TCF_HMG-box 296..367 CDD:238684 23/69 (33%)
sox-4NP_001335567.1 SOX-TCF_HMG-box 120..191 CDD:238684 23/69 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.