DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bbx and SOX21

DIOPT Version :9

Sequence 1:NP_001027087.1 Gene:bbx / 3772670 FlyBaseID:FBgn0024251 Length:769 Species:Drosophila melanogaster
Sequence 2:NP_009015.1 Gene:SOX21 / 11166 HGNCID:11197 Length:276 Species:Homo sapiens


Alignment Length:296 Identity:62/296 - (20%)
Similarity:100/296 - (33%) Gaps:72/296 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 TRPEHHARRPMNAFLIFCKRHRGIVKERYKTLENRAITKILGDWWAALDEQEKHCFTDLAQQNKD 355
            ::|..|.:||||||:::.:..|..:.:....:.|..|:|.||..|..|.|.||..|.|.|::.:.
Human     2 SKPVDHVKRPMNAFMVWSRAQRRKMAQENPKMHNSEISKRLGAEWKLLTESEKRPFIDEAKRLRA 66

  Fly   356 AFFNANPNFKW--------------YKLPA------------PPLRTLATRPSNASAGLLIPSED 394
            .....:|::|:              :..|.            |.|:..|...:.|..||      
Human    67 MHMKEHPDYKYRPRRKPKTLLKKDKFAFPVPYGLGGVADAEHPALKAGAGLHAGAGGGL------ 125

  Fly   395 QPQQQVPTSLQVQWAERGEMPRAMLRPNYFKLADETQMGELSSLLQVQVQEKDFALQQVLSETSQ 459
                 ||.||                     ||:..:....::....:|    |..|..      
Human   126 -----VPESL---------------------LANPEKAAAAAAAAAARV----FFPQSA------ 154

  Fly   460 FLSAHMPAGNTNGNGNKRSLQDNNSSNSSEEEAASGSSPNKKVKSSRSCKGKIYQELVNSGQLAA 524
              :|...|......|:..||.|..|..:....::||......:....:..|..:.....:...||
Human   155 --AAAAAAAAAAAAGSPYSLLDLGSKMAEISSSSSGLPYASSLGYPTAGAGAFHGAAAAAAAAAA 217

  Fly   525 IAKKSKARLPPAGNMGGNFVDIPLDAGPNTPPVSPP 560
            .|.......|..|| .|..:.....|.| :|.:.||
Human   218 AAGGHTHSHPSPGN-PGYMIPCNCSAWP-SPGLQPP 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bbxNP_001027087.1 SOX-TCF_HMG-box 296..367 CDD:238684 23/84 (27%)
SOX21NP_009015.1 SOX-TCF_HMG-box 7..78 CDD:238684 23/70 (33%)
SOXp 77..>95 CDD:403523 0/17 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.