DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: bbx and bbx

Sequence 1:NP_001027087.1 Gene:bbx FlyBaseID:FBgn0024251 Length:769 Species:Drosophila melanogaster
Sequence 2:XP_002932333.2 Gene:bbx XenbaseID:XB-GENE-981428 Length:962 Species:Xenopus tropicalis

Alignment Length:638 Identity:166/639 (26%)
Similarity:255/639 (40%) Gaps:198/639 (31%)


  Fly   218 DDEEEDLDEEEDDEEEAEIQVQLPVQQEVTRIRREAAEEHVDVDVVTVPQQEQDQYSHQVEPRQL 282
            |..||  ||||:|||:.: :|||                 :|.|                   .|
 Frog   101 DFSEE--DEEEEDEEDID-KVQL-----------------LDGD-------------------GL 126

  Fly   283 QQDETADNTRPEHHARRPMNAFLIFCKRHRGIVKERYKTLENRAITKILGDWWAALDEQEKHCFT 347
            :.|||.||...|..|||||||||:||||||.:|::.:..|:||..||||.||||.||..||..:|
 Frog   127 ENDETEDNDSSEQRARRPMNAFLLFCKRHRSLVRQEHPRLDNRGATKILADWWAYLDPNEKQKYT 191

  Fly   348 DLAQQNKDAFFNANPNFKWYKLPAPPLRTLATRPSNASAGLLIPSEDQPQQQVPTSLQVQWAERG 412
            |:|::.||||..|||.:||......|::  |..|:..:...|.....:..:.||:..:|  .:..
 Frog   192 DMAKEYKDAFMKANPGYKWCPTTNKPVK--AHSPTVTTRKKLWSFSSETVKDVPSPKKV--PQED 252

  Fly   413 EMPRAMLRPNYFKLADETQMGELSSLL-----------------QVQ------------------ 442
            |||:.     .|.:||.||||.||.||                 :|:                  
 Frog   253 EMPQL-----NFSIADPTQMGGLSMLLLAGEHALTAHGDHAVTERVEHLLSDHEVSSGICPLTES 312

  Fly   443 ---VQEKD---FALQQVLSETS-----------------QFLSAHMPAGNTNGNGNKRSLQDNNS 484
               .:.:|   |...::.|.||                 ||.........|..|....:....||
 Frog   313 GFPQENRDTSLFQFDEISSSTSHSDDPAPAEQSEKSTLFQFAEISSDTSQTQINCVDPAKCCGNS 377

  Fly   485 SNSSEEEAASGSSPNKKVKSSRSC-KGKIYQELVNSGQLAAIAKKSKARLPPAGNMGGNFVDIPL 548
            |.....|.:|.||.:....|::.| ...::       |||.:.:.|:|            |.|.:
 Frog   378 SLFQLAEISSSSSHSDSSASAKQCGTSALF-------QLAEMCEASEA------------VKIEI 423

  Fly   549 DAGPNT-----PPVSPPER-QGSSPDSMQK------HIRSVSESSSSGFFDLEEKIKELPALSLD 601
            ....:|     .|||..|. :.||.|.:.:      ||...:|:::.       |.|:..|.:|:
 Frog   424 SRNVDTDDLVRTPVSIKEEIESSSEDLISRNLNDSSHICEKAETNNI-------KTKKHKAHTLE 481

  Fly   602 -------AYLQRKRSTKKKKK---------FSGTKKQRNSNSTSGASATSNVAAADAAAKG---- 646
                   ..|:|::..|||||         .:..||......:|.:...|.:...:|.|||    
 Frog   482 PIDAELLGLLKREKLKKKKKKNKSDHDAAEKASPKKTCKKRQSSESDIESVMYTIEAVAKGDWGI 546

  Fly   647 -AVPLSSEQHVRIK----------QQQLQAVGSQRRKARKE--SITRRDVSAIEQEV-ASILPLT 697
             .:|:|..:..||.          :...:.|.|:.:|.:|:  |.:.:::||.|..: |.|:.| 
 Frog   547 EQIPISPSKKARISTSPKHSIFDLKSAKKKVKSKEKKMQKDKPSDSTKELSAPEHIITAPIIDL- 610

  Fly   698 INGSYYFNQSGAPKAVNA-PVTSSSASPPL---------SSNSSSSSSSLSSQ 740
                    .|..|::|.: |.:.:...||:         ..||:..:.:..|:
 Frog   611 --------PSETPESVKSEPPSPTEELPPMCLPEMLKTEDFNSNKKTETCGSR 655

Known Domains:


GeneSequenceDomainRegion External IDIdentity
bbxNP_001027087.1 SOX-TCF_HMG-box 296..367 CDD:238684 43/71 (61%)
bbxXP_002932333.2 SOX-TCF_HMG-box 140..211 CDD:238684 28/71 (39%)
DUF2028 253..384 CDD:286715 38/189 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005462
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.