DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: bbx and bbx

Sequence 1:NP_001027087.1 Gene:bbx FlyBaseID:FBgn0024251 Length:769 Species:Drosophila melanogaster
Sequence 2:XP_009303743.1 Gene:bbx ID: Length:899 Species:Danio rerio

Alignment Length:580 Identity:143/581 (25%)
Similarity:228/581 (39%) Gaps:169/581 (29%)


  Fly   223 DLDEEEDDEEEAEIQVQLPVQQEVTRIRREAAEEHVDVDVVTVPQQEQDQYSHQVEPRQLQQDET 287
            |..|||::|:|.|::.: ||.         .||..|........:.:.::||             
Zfish    38 DFSEEEEEEDEEELEKE-PVL---------CAESSVQEGECGGMEDDSEEYS------------- 79

  Fly   288 ADNTRPEHHARRPMNAFLIFCKRHRGIVKERYKTLENRAITKILGDWWAALDEQEKHCFTDLAQQ 352
                 .|..|||||||||:||||||.:|::.:..|:||..||||.||||.||.:||..:||:|::
Zfish    80 -----SEQRARRPMNAFLLFCKRHRSLVRQEHPRLDNRGATKILADWWAVLDPKEKQKYTDMAKE 139

  Fly   353 NKDAFFNANPNFKWYKLPAPPLRT-----------LATRPSNASAGLLIPSEDQPQQQVPTSLQV 406
            .||||..|||.:||......|:::           :.:.|||.|..   ||..:.|.:..::.|:
Zfish   140 YKDAFMKANPGYKWCPATNKPVKSPSHSVSNSRKKVWSLPSNPSKD---PSVAKKQPKTDSTPQL 201

  Fly   407 QWAERGEMPRAMLRPNYFKLADETQMGELSSLLQVQVQEKDFALQQVLSETSQ------------ 459
            .                |.:||..:||.||.||  ...|.....:::.|.:||            
Zfish   202 N----------------FAMADPNKMGGLSMLL--LAGEHALTAREISSSSSQTGCTDVAKHTGK 248

  Fly   460 ---FLSAHMPAGNTNGNGNKRSLQDNNSSNSSEEEAASGSSPNKKVKSSRSC-KGKIYQ--ELVN 518
               |..|.:.:......|..::.:|.:|....|   |||.|........:|| |..::|  |.::
Zfish   249 SALFQLAEISSSPAQSAGGSKNAEDTSSLTHVE---ASGPSQPSSPDLPKSCVKSPLFQLAEQIS 310

  Fly   519 S------------GQ----------LAAIAKKSKAR-LPPAGNMGG----NFVDIPLDAGPNTPP 556
            |            ||          ||:.|:|.:|| ..|:|....    |..:|          
Zfish   311 SSRSPSASEGRQCGQSALFQLAEMCLASEAEKMEARSSQPSGGSSSLCAQNSTEI---------- 365

  Fly   557 VSPPERQGSSPDSMQKHIRSVSESSSSGFFDLEEKIKELPALSLDAYLQRKRSTKKKKKFSGTK- 620
               |:|: ...::.:..:.:.|.:|:||      .....|..:......:|:..||:.|.|... 
Zfish   366 ---PDRE-EQKETSELPLTTSSSTSTSG------STSSTPTETSPCKTPKKKKKKKENKESDENP 420

  Fly   621 ------KQRNSNSTSGASATSNVAAADAAAKGA---------VPLSSEQHVRIKQQQLQAVGSQR 670
                  |:|.|..:...|.|..:   :|..|||         .|...|....:..:|..:|..:.
Zfish   421 ASPKKMKKRQSPESDLDSVTFTI---EAVVKGAWGSEETPKKKPRPPESESSLTAEQSPSVKKKT 482

  Fly   671 RKARKESITRRDVSAIEQEVASILPLTINGSYYFNQSGAPKAVNAP-----VTSSSASPP 725
            :...|:.:..:| .|:::|                :..|.|..|.|     :|..:...|
Zfish   483 KPKPKKQLKLKD-DAMQEE----------------EEDADKVANKPQDVEMITEEAPMTP 525

Known Domains:


GeneSequenceDomainRegion External IDIdentity
bbxNP_001027087.1 SOX-TCF_HMG-box 296..367 CDD:238684 43/71 (61%)
bbxXP_009303743.1 SOX-TCF_HMG-box 83..154 CDD:238684 31/71 (44%)
DUF2028 199..344 CDD:312980 40/185 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C366244990
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005462
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR13059
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.