DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mei-218 and mcm6

Sequence 1:NP_001027068.1 Gene:mei-218 FlyBaseID:FBgn0002709 Length:1186 Species:Drosophila melanogaster
Sequence 2:NP_596614.1 Gene:mcm6 PomBaseID:SPBC211.04c Length:892 Species:Schizosaccharomyces pombe

Alignment Length:903 Identity:166/904 (18%)
Similarity:293/904 (32%) Gaps:301/904 (33%)


  Fly   416 ASVTNNSSAPIRIAPRQQTTQSSGPSVVHNEDEDVMPPTPNQSERRQ-----RRFPRR---NHNP 472
            ||..||:|.|......|.:.....|:|       .||..|..|...:     :|.|..   ...|
pombe     5 ASQGNNASTPAYRYGFQTSEVGDRPTV-------SMPSQPESSAMLEDDGMVKRKPFAAIGEAIP 62

  Fly   473 RMVRSL-QAVSREFTESLLEGSSGKTPEKEVVPYQQQEK--PRQVK--SSPEIHA--------SS 524
            :::.:. ::|...|.|.||..|..:....:.:|...|||  .:|:.  :..|||.        :|
pombe    63 KVIDTTGESVREAFEEFLLSFSDDRVAGGDALPSASQEKYYVQQIHGLAMYEIHTVYVDYKHLTS 127

  Fly   525 HMRKLAMGSVLNSNAKEFHPTGESHLTHKVSRLSQRRCRQRFTRSLHAKKNNPREQLPNPDSAPE 589
            :...||:..|  .....|.|    .|...:.:|.: :....:.||..:::|  ....||..::  
pombe   128 YNDVLALAIV--EQYYRFSP----FLLRALQKLIE-KFEPEYYRSSLSREN--ASLSPNFKAS-- 181

  Fly   590 PILEYTSEIDDQPCPPRQTV-DTPIEAIVPPAMI--EVSATGNLPPVF----YFDQQSGIIWSN- 646
               :.|..:.....|.|.|: |...:.|.....|  .|:.|..:.|..    :..::...:.|| 
pombe   182 ---DKTFALAFYNLPFRSTIRDLRTDRIGRLTTITGTVTRTSEVRPELAQGTFICEECHTVVSNV 243

  Fly   647 ------SSP-QIPVEIQSN------SVSQSVFR---------------LASLP------------ 671
                  :.| |.|.|:.:|      ::|||.|:               ..|:|            
pombe   244 EQAFRYTEPTQCPNELCANKRSWRLNISQSSFQDWQKVRIQENSNEIPTGSMPRTLDVILRGDIV 308

  Fly   672 --------C--TGVGTTNMDIFTSSPPPIQHMS-------SSRLPSSISGPTQLSHTLSSPPVEN 719
                    |  ||:.....|:.....|.::..:       ..|....::|       |.|..|.:
pombe   309 ERAKAGDKCAFTGILIAVPDVSQLGIPGVKPEAYRDSRNFGGRDADGVTG-------LKSLGVRD 366

  Fly   720 QHQQHLWESCIHQDEDLMYSRPLLDMDQEETQP-EQQDQEWQWESEIEPPSFQSENQVVADEHGE 783
            ...:..:.:|:.|.:| ...:...|:..:.:|. |:||:           ..||.:|   :|..:
pombe   367 LTYKLSFLACMVQPDD-ANDKSGADVRGDGSQGIEEQDE-----------FLQSLSQ---EEIDD 416

  Fly   784 ENAYLAKDAGPPLERHMIFR-----APSQHGQEYPKPDLNCVPSSIKKLHHLISSQYSDYSFVYA 843
            ..|.:..|       |:..|     |||.:|.|..|                             
pombe   417 LRAMVHSD-------HIYSRLTNSLAPSVYGHEIIK----------------------------- 445

  Fly   844 LSAQISQDCVPMDCFVYLKMILLASIVSI-----ESDEVRAPISLCIIATDSLMANRLLNKVGQL 903
                              |.|||..:..:     |...:|..:::||:...|...::.|..|...
pombe   446 ------------------KGILLQLMGGVHKLTPEGINLRGDLNICIVGDPSTSKSQFLKYVCNF 492

  Fly   904 APRFLGPHEYGLQPTFNAL--------PTRFNWIVASPLLLAQQGVYYAGDWNRLSKDQGCQLEK 960
            .||.:  :..|...:...|        .|....|.|..|:||..|:....:::::.......:.:
pombe   493 LPRAI--YTSGKASSAAGLTAAVVKDEETGDFTIEAGALMLADNGICAIDEFDKMDLSDQVAIHE 555

  Fly   961 CIENGAVPVPQLHIDQPLKAAVWTYWQPNNSTNQTLALAKLCPIFGLPIYMGAQASNSLWNSIIQ 1025
            .:|...:.:.:..|...|.|             :|..||...||.|                   
pombe   556 AMEQQTISIAKAGIQATLNA-------------RTSILAAANPIGG------------------- 588

  Fly  1026 KHNAEGQIVVNDGLSIP-----------------EDDMRMLIHL--LHQRKTTLTDGAQ------ 1065
            ::|.:..:..|..:|.|                 ..|..:..|:  :|:    |.|.|.      
pombe   589 RYNRKTTLRNNINMSAPIMSRFDLFFVVLDECNESVDRHLAKHIVDIHR----LRDDAMQPEFST 649

  Fly  1066 HMLQKYYVISRKERPNVFSS------KTYIVLKQL----AECFAKLALRLEV--LESDVCVAIFH 1118
            ..||:|...:|..:|.:.:.      |.|   |||    |:...|.:.|:.|  |||.:      
pombe   650 EQLQRYIRYARTFKPKLNTESCAEIVKKY---KQLRMDDAQGAGKNSYRITVRQLESMI------ 705

  Fly  1119 CEHFVQGIFGAKENQAPPAVFNFNVISCIDP-YMNKFTRWLLQYLNSYEDEELGMHAD 1175
                          :...|:...|.:..|.| ::|:....|.|.:...|.:::.:..|
pombe   706 --------------RLSEAIARANCVDDITPAFVNEAYSLLRQSIIHVERDDIEVEED 749

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mei-218NP_001027068.1 PTZ00112 122..>417 CDD:240274 1/1 (100%)
MCM <1023..1116 CDD:278895 27/130 (21%)
mcm6NP_596614.1 MCM_N 75..209 CDD:291233 32/148 (22%)
MCM 194..737 CDD:214631 119/680 (18%)
P-loop_NTPase <527..616 CDD:304359 18/121 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11630
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.