DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mei-218 and MCMDC2

Sequence 1:NP_001027068.1 Gene:mei-218 FlyBaseID:FBgn0002709 Length:1186 Species:Drosophila melanogaster
Sequence 2:NP_775789.3 Gene:MCMDC2 HGNCID:26368 Length:681 Species:Homo sapiens

Alignment Length:537 Identity:132/538 (25%)
Similarity:214/538 (40%) Gaps:108/538 (20%)


  Fly   702 ISGPTQLSHTLSSPPVENQHQQHLWESCIHQDEDLMYSRPLLDMDQEETQPEQQDQEWQWESEIE 766
            :.|.|:      |..:.|....:|..|.:.:|...   |.|.|....|....:..:.:|..|..:
Human   169 VPGATE------SATIRNDFLCNLCASSLQEDRKF---RVLGDKQIVEIIATKALRAFQGYSNNQ 224

  Fly   767 PPSFQSENQVVADEHGEE----NAYLAKDAGPP-----------LERHMIFRAPSQHGQEYPKPD 816
            |..|||....:.||...:    |.|  |..|.|           :|.:.|....|:         
Human   225 PFRFQSLTIFLRDESVNKMNIGNEY--KIIGIPTCVKTSQTAVCIEANSITFCNSK--------- 278

  Fly   817 LNCVPSSI----KKLHHLISSQYSDYSFVYALSAQISQDCVPMDCFVYLKMILLASIVSI--ESD 875
               |||.|    :.|..|.||  |.:.|...|:...:....|...:..||:.||.|:|..  .:.
Human   279 ---VPSGISDNFRCLLSLTSS--SCWKFTAILANIFASQITPPGTYNLLKLCLLMSLVQTTDRNK 338

  Fly   876 EVRAPISLCIIATDSLMANRLLNKVGQLAPRFLGPHEYGLQ--------PTF--NALPTRFNWIV 930
            |:...:.:.||.:|:|:.:||||....|.||       |::        ||.  |...|....|.
Human   339 ELEDCLDILIITSDTLLIDRLLNFSINLVPR-------GIRHLVSTEIFPTLSRNKYGTGAVSIQ 396

  Fly   931 ASPLLLAQQGVYYAGDWNRLSKDQGCQLEKCIENGAVPV--PQL----HIDQ----PLKAAVWTY 985
            |...|||:.|:.:.||.....||:..||:..:|:.::.|  |..    .|||    |::.:.|::
Human   397 AGSALLAKGGICFIGDLASHKKDKLEQLQTVLESRSITVYIPGKKFGEDIDQQMTFPVQCSFWSF 461

  Fly   986 WQPNNSTNQ--------------TLALAKLCPIFGLPIYMGAQAS-----NSLWNSIIQKHNAEG 1031
            ...::|:.:              :|..|.|...|||.|.....:.     .::.:::.:..|.||
Human   462 VDVDSSSRRNAQKINTLIGQMDCSLIPANLVEAFGLLINCNESSPCHPFLPTVQHTLNKAINPEG 526

  Fly  1032 QIVVNDGLSIPEDDMRMLIHLLHQRKTTLTDGAQHMLQKYYVISRKERP-NVFSSK------TYI 1089
             :..........:|...|:..........:..|:.|...||:.||:.|. :|..||      .|:
Human   527 -LFYAASRQFTTEDFEKLLAFAKNLNVEFSLEAERMTHGYYLASRRIRTGSVCGSKLSASALKYL 590

  Fly  1090 VLKQLAECFAKLALRLEVLESDVCVAIFHCEHFVQGIFGAKE-NQAPPAVFNFNV-----ISCID 1148
            |.  |:|..|:|.||.:||:.||.:|....|..:...:||.. ..||.|||.|.:     :...|
Human   591 VF--LSEAHARLNLRNKVLKEDVLIAALLFETSLTLKYGATVFCVAPNAVFPFELYNEEYLEQRD 653

  Fly  1149 PYMNKFTRWLLQYLNSY 1165
            .|:.:..:.|.|::.:|
Human   654 LYLTQCQQQLEQFIATY 670

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mei-218NP_001027068.1 PTZ00112 122..>417 CDD:240274
MCM <1023..1116 CDD:278895 28/100 (28%)
MCMDC2NP_775789.3 PTZ00111 <358..>435 CDD:173403 25/84 (30%)
MCM <514..622 CDD:278895 29/111 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007387
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_137119
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R7620
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.