DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shawn and DPCoAC

DIOPT Version :8

Sequence 1:NP_001027071.1 Gene:Shawn / 3772641 FlyBaseID:FBgn0031039 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster

Alignment Length:414 Identity:94/415 (23%)
Similarity:154/415 (37%) Gaps:120/415 (29%)


  Fly     1 MATREACGQFAAA-SAAMAAASSQ-----------NPSKAT--MTDPRFRIRPLQQ--------- 42
            |:.:....|.::. :.|.|..||.           :||:.:  :..|...:.|::|         
  Fly    12 MSIKSTGSQLSSTMTTASATLSSDLDDADTSRTQLSPSETSGVVLVPATTVTPMRQKIDQVVISL 76

  Fly    43 VASACTGAMVTACFMTPLDVIKTRLQAQQQALLSNKCFL------YCNGLMDHICPCGPDTPNPA 101
            ::.|..||:... .:.|||..|...|.:.....|.:..|      |.|                 
  Fly    77 ISGAAAGALAKT-VIAPLDRTKINFQIRNDVPFSFRASLRYLQNTYAN----------------- 123

  Fly   102 AAKPAPRFSGTIDAFIKISRTEGIGSLWSGLSPTLISALPSTIIYFVAYEQFKARFTDIHYKYT- 165
                                 ||:.:||.|.|.|:...:|...|.|.|:||:: |...:....| 
  Fly   124 ---------------------EGVLALWRGNSATMARIVPYAAIQFTAHEQWR-RILHVDKDGTN 166

  Fly   166 ---RRPDTIAHDIPHPIPFLVPLLAGVSGRILAVTCVSPVELIRTKMQ-SQRMTHAEMFGTIRQV 226
               ||             ||...|||::.:.|..    |::|.|.:|. :.|.|.   :.|:|||
  Fly   167 TKGRR-------------FLAGSLAGITSQSLTY----PLDLARARMAVTDRYTG---YRTLRQV 211

  Fly   227 VQ----SQGVLGLWRGLPPTILRDVPFSGIYWTCYEYLKSSF----GVVEPTFSFSFAAGAISGS 283
            ..    .:|...|:||...|:|..:|::|..:..||.||..:    |..:|....|.|.||.:|:
  Fly   212 FTKIWVEEGPRTLFRGYWATVLGVIPYAGTSFFTYETLKREYYEVVGNNKPNTLVSLAFGAAAGA 276

  Fly   284 VAATITTPFDVVKTHEQ-----IEFGEKFIFSDNPPKQVATKSVAMRLASIYRMGGVP-AIFSGL 342
            ...|.:.|.|:|:...|     ...|:::            .::...|..|||..||. ..:.||
  Fly   277 AGQTASYPLDIVRRRMQTMRVNTAGGDRY------------PTILETLVKIYREEGVKNGFYKGL 329

  Fly   343 GPRLFKVAPACAIMISSFEYGKSF 366
            .....|...|..|..|:::..|::
  Fly   330 SMNWIKGPIAVGISFSTYDLIKAW 353

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ShawnNP_001027071.1 Mito_carr 39..159 CDD:278578 28/135 (21%)
Mito_carr 178..265 CDD:278578 28/96 (29%)
Mito_carr 268..371 CDD:278578 25/106 (24%)
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 26/127 (20%)
Mito_carr 169..251 CDD:278578 30/102 (29%)
Mito_carr 279..356 CDD:278578 19/88 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1997403
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.