DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gr64d and Gr5a

Sequence 1:NP_001027105.2 Gene:Gr64d FlyBaseID:FBgn0035486 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_511050.1 Gene:Gr5a FlyBaseID:FBgn0003747 Length:444 Species:Drosophila melanogaster

Alignment Length:394 Identity:114/395 (29%)
Similarity:200/395 (51%) Gaps:19/395 (5%)


  Fly     5 VQENTLHYTIGHVLIIARIFGVLPLAGINP---NGKPENVR-FR-WFSPYILFFVVAFTFVIADF 64
            :.:.:.|..:..||.:|:.|.::|:.||:.   .|...|.| :| |:|...|    ..|.|  |.
  Fly    48 LHDGSFHEAVAPVLAVAQCFCLMPVCGISAPTYRGLSFNRRSWRFWYSSLYL----CSTSV--DL 106

  Fly    65 MLSTKIVLNDGLQLYTMGSLSFSVICIFCFGSFIKLSRRWPHIIRETALCERIFLKPCY-ANQEG 128
            ..|.:.|.:..|.:.::..:.|.|..:.....|:.|::.||.::|..|..||..  |.| ...:.
  Fly   107 AFSIRRVAHSVLDVRSVEPIVFHVSILIASWQFLNLAQLWPGLMRHWAAVERRL--PGYTCCLQR 169

  Fly   129 LNFTRFLRRWALILLVAALCEHLTYVGSAAWSNYVQIRDCNLKVGFVENYFLRERQELFSVFEYR 193
            ....|.|:..|.:|||.:|.|||..:.|..:.::     |..:...||:|.|....:||.||.|.
  Fly   170 ARPARRLKLVAFVLLVVSLMEHLLSIISVVYYDF-----CPRRSDPVESYLLGASAQLFEVFPYS 229

  Fly   194 AWMVFFIEWNTMAMTFVWNFGDIFLFLMCRGLKIRFQQLHWRIRQNLGKPMAKEFWQEIRSDFLD 258
            .|:.:..:...:.:||.|::.||||.::..||.....:|:..:.|.:.:||.:.:|...|:.:..
  Fly   230 NWLAWLGKIQNVLLTFGWSYMDIFLMMLGMGLSEMLARLNRSLEQQVRQPMPEAYWTWSRTLYRS 294

  Fly   259 LDSLLKLYDKELSGLILVCCAHNMYFICVQVYHSFQVKGAFMDELYFWFCLLYVISRLMNMMLAA 323
            :..|::..|..:||::|:....|:||||:|:..|.....:....:||:|.||:::||...::|..
  Fly   295 IVELIREVDDAVSGIMLISFGSNLYFICLQLLKSINTMPSSAHAVYFYFSLLFLLSRSTAVLLFV 359

  Fly   324 SSIPQEIKDISNTLYEVRSSPWCDELGRLSEMLRNETFALSGMGYFYVTRRLIFAMAGALMGYEL 388
            |:|..:.::....|..|....:..|:.|.:..|.::..||:|:.:|.|||:|..||||.:..|||
  Fly   360 SAINDQAREPLRLLRLVPLKGYHPEVFRFAAELASDQVALTGLKFFNVTRKLFLAMAGTVATYEL 424

  Fly   389 VLFR 392
            ||.:
  Fly   425 VLIQ 428

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gr64dNP_001027105.2 Trehalose_recp 1..404 CDD:253587 114/395 (29%)
Gr5aNP_511050.1 7tm_7 46..437 CDD:303125 114/395 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131090493
eggNOG 1 0.900 E1_28M3V
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005347
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21421
RoundUp 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.