DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gr64d and Gr61a

Sequence 1:NP_001027105.2 Gene:Gr64d FlyBaseID:FBgn0035486 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001261226.1 Gene:Gr61a FlyBaseID:FBgn0035167 Length:436 Species:Drosophila melanogaster

Alignment Length:403 Identity:113/404 (28%)
Similarity:198/404 (49%) Gaps:32/404 (8%)


  Fly     6 QENTLHYTIGHVLIIARIFGVLPLAGINPNGKPENVRFRWFSPYILFFVVAFTFVIADFM---LS 67
            |.:|.:..|...|.:|:.||::||:.|. :..|::|:|:..|   :...|...|::...|   :.
  Fly    38 QLDTFYGAIRPYLCVAQFFGIMPLSNIR-SRDPQDVKFKVRS---IGLAVTGLFLLLGGMKTLVG 98

  Fly    68 TKIVLNDGLQLYTMGSLSFSVICIFCFGSFIKLSRRWPHIIRETALCERIFLKPCYANQEGLNFT 132
            ..|:..:||....:..|.|.::.:..:.:|:..:|.|.||:...:..:.:.|.|.|...:     
  Fly    99 ANILFTEGLNAKNIVGLVFLIVGMVNWLNFVGFARSWSHIMLPWSSVDILMLFPPYKRGK----- 158

  Fly   133 RFLRR----WALILLVAALCEHLTYVGSAAWSNYVQIRDCN-----LKVGFVENYFLRERQELFS 188
            |.||.    .||.::|.|:.:|:.|..|...|..:.|..|:     :..|.   |..:|..::..
  Fly   159 RSLRSKVNVLALSVVVLAVGDHMLYYASGYCSYSMHILQCHTNHSRITFGL---YLEKEFSDIMF 220

  Fly   189 VFEYRAWMVFFIEWNTMAMTFVWNFGDIFLFLMCRGLKIRFQQLHWRIRQNLGKPMAKEFWQEIR 253
            :..:..:.:.:..|...|.||:|||.|||:.:...||..||||...|:....|:.:.:..|.:||
  Fly   221 IMPFNIFSMCYGFWLNGAFTFLWNFMDIFIVMTSIGLAQRFQQFAARVGALEGRHVPEALWYDIR 285

  Fly   254 SDFLDLDSLLKLYDKELSGLILVCCAHNMYFICVQVYHSFQVKGAFMDELYFWFCLLYVISRLMN 318
            .|.:.|..|..|.:..:|.::.|.||:|:|.||.|....|......::.:|||:.|:::::|...
  Fly   286 RDHIRLCELASLVEASMSNIVFVSCANNVYVICNQALAIFTKLRHPINYVYFWYSLIFLLARTSL 350

  Fly   319 MMLAASSIPQEIKDIS----NTLYEVRSSPWCDELGRLSEMLRNETFALSGMGYFYVTRRLIFAM 379
            :.:.||    :|.|.|    .:||.|.|..|..|:.|.::.|.:|...|||...|.:||:.:|.|
  Fly   351 VFMTAS----KIHDASLLPLRSLYLVPSDGWTQEVQRFADQLTSEFVGLSGYRLFCLTRKSLFGM 411

  Fly   380 AGALMGYELVLFR 392
            ...|:.|||:|.:
  Fly   412 LATLVTYELMLLQ 424

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gr64dNP_001027105.2 Trehalose_recp 1..404 CDD:253587 113/404 (28%)
Gr61aNP_001261226.1 Trehalose_recp 1..434 CDD:253587 113/404 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131090469
eggNOG 1 0.900 E1_28M3V
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005347
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21421
RoundUp 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.