DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gr64d and Gr64b

Sequence 1:NP_001027105.2 Gene:Gr64d FlyBaseID:FBgn0035486 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_728921.1 Gene:Gr64b FlyBaseID:FBgn0045478 Length:406 Species:Drosophila melanogaster

Alignment Length:408 Identity:127/409 (31%)
Similarity:216/409 (53%) Gaps:21/409 (5%)


  Fly     6 QENTLHYTIGHVLIIARIFGVLPLAGINPNGKPENVRFRWFSPYILFFVVAFTFVIADFMLSTKI 70
            |..|.|..:.:||.|::|:|:||::.:......: :||||.||.||:.::.....:::|......
  Fly     3 QGETFHRAVSNVLFISQIYGLLPVSNVRALDVAD-IRFRWCSPRILYSLLIGILNLSEFGAVINY 66

  Fly    71 VLNDGLQLYTMGSLSFSVICIFCFGSFIKLSRRWPHIIRETALCERIFLKPCYANQEGLNFTRFL 135
            |:...:..:|..:||..::|:.....|.:|:.:||.|:|.....|::||:..|         ||.
  Fly    67 VIKVTINFHTSSTLSLYIVCLLEHLFFWRLAIQWPRIMRTWHGVEQLFLRVPY---------RFY 122

  Fly   136 RRWAL---------ILLVAALCEHLTYVGSAAWSNYVQIRDCNLKVGFVENYFLRERQELFSVFE 191
            ..:.:         |::.:||.||...:|::...:.::...|.:.|.:.|:.:..||..|:.:..
  Fly   123 GEYRIKRRIYIVFTIVMSSALVEHCLLLGNSFHLSNMERTQCKINVTYFESIYKWERPHLYMILP 187

  Fly   192 YRAWMVFFIEWNTMAMTFVWNFGDIFLFLMCRGLKIRFQQLHWRIRQNLGKPMAKEFWQEIRSDF 256
            |..||:..:||....:.:..:|.|.|:..:..||..||.||:.||.....|.|...||.|:|..:
  Fly   188 YHFWMLPILEWVNQTIAYPRSFTDCFIMCIGIGLAARFHQLYRRIAAVHRKVMPAVFWTEVREHY 252

  Fly   257 LDLDSLLKLYDKELSGLILVCCAHNMYFICVQVYHSFQVKGA-FMDELYFWFCLLYVISRLMNMM 320
            |.|..|:.|.|..::.|:|:...:||.|||.|:::||:..|. |:..|.||:.|.:.:.|.:..:
  Fly   253 LALKRLVHLLDAAIAPLVLLAFGNNMSFICFQLFNSFKNIGVDFLVMLAFWYSLGFAVVRTLLTI 317

  Fly   321 LAASSIPQEIKDISNTLYEVRSSPWCDELGRLSEMLRNETFALSGMGYFYVTRRLIFAMAGALMG 385
            ..||||....:.|...|.:|.|..|..|:.|.||.|.|:|.||||.|:||:||.|:.||...::.
  Fly   318 FVASSINDYERKIVTALRDVPSRAWSIEVQRFSEQLGNDTTALSGSGFFYLTRSLVLAMGTTIIT 382

  Fly   386 YELVLFRQM-QGAVVQKS 402
            |||::...: ||::.||:
  Fly   383 YELMISDVINQGSIRQKT 400

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gr64dNP_001027105.2 Trehalose_recp 1..404 CDD:253587 127/409 (31%)
Gr64bNP_728921.1 Trehalose_recp 3..400 CDD:253587 127/407 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131090232
eggNOG 1 0.900 E1_28M3V
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005347
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21421
RoundUp 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.