DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gr64d and Gr64c

Sequence 1:NP_001027105.2 Gene:Gr64d FlyBaseID:FBgn0035486 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001246610.1 Gene:Gr64c FlyBaseID:FBgn0045477 Length:419 Species:Drosophila melanogaster

Alignment Length:418 Identity:254/419 (61%)
Similarity:318/419 (76%) Gaps:3/419 (1%)


  Fly     1 MERSVQE---NTLHYTIGHVLIIARIFGVLPLAGINPNGKPENVRFRWFSPYILFFVVAFTFVIA 62
            |::|.|:   |||.:.||.||:||:.|||||:||:.|:.:||.|||||.|..:|..::.|.|.|.
  Fly     1 MQQSGQKGTRNTLQHAIGPVLVIAQFFGVLPVAGVWPSCRPERVRFRWISLSLLAALILFVFSIV 65

  Fly    63 DFMLSTKIVLNDGLQLYTMGSLSFSVICIFCFGSFIKLSRRWPHIIRETALCERIFLKPCYANQE 127
            |..||:|:|.:.||::||:||||||||||||||.|:.||||||:|||.||.||:|||:|.|....
  Fly    66 DCALSSKVVFDHGLKIYTIGSLSFSVICIFCFGVFLLLSRRWPYIIRRTAECEQIFLEPEYDCSY 130

  Fly   128 GLNFTRFLRRWALILLVAALCEHLTYVGSAAWSNYVQIRDCNLKVGFVENYFLRERQELFSVFEY 192
            |..::..||.|.:.:||||||||.||||||.::|::.|.:|.|...|.:|||.||||:||.:..:
  Fly   131 GRGYSSRLRLWGVCMLVAALCEHSTYVGSALYNNHLAIVECKLDANFWQNYFQRERQQLFLIMHF 195

  Fly   193 RAWMVFFIEWNTMAMTFVWNFGDIFLFLMCRGLKIRFQQLHWRIRQNLGKPMAKEFWQEIRSDFL 257
            .||.:.||||.|::|||||||.||||.|:|||:::||||:||||||::.:.|..||||.||.|.|
  Fly   196 TAWWIPFIEWTTLSMTFVWNFVDIFLILICRGMQMRFQQMHWRIRQHVRQQMPNEFWQRIRCDLL 260

  Fly   258 DLDSLLKLYDKELSGLILVCCAHNMYFICVQVYHSFQVKGAFMDELYFWFCLLYVISRLMNMMLA 322
            ||..||.:|||||||||::.|||||||:|||:|||||.||.:.|||||||||.|||.|::|||.|
  Fly   261 DLSDLLGIYDKELSGLIVLSCAHNMYFVCVQIYHSFQSKGNYADELYFWFCLSYVIIRVLNMMFA 325

  Fly   323 ASSIPQEIKDISNTLYEVRSSPWCDELGRLSEMLRNETFALSGMGYFYVTRRLIFAMAGALMGYE 387
            |||||||.|:||.||||:.:..||.||.||:|:..::.|||||.|||.:|||||||||..||.||
  Fly   326 ASSIPQEAKEISYTLYEIPTEFWCVELRRLNEIFLSDHFALSGKGYFLLTRRLIFAMAATLMVYE 390

  Fly   388 LVLFRQMQGAVVQKSICSRGPGSSMSIF 415
            |||..||.|:.||||.|..|.|||.|||
  Fly   391 LVLINQMAGSEVQKSFCEGGVGSSKSIF 418

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gr64dNP_001027105.2 Trehalose_recp 1..404 CDD:253587 246/406 (61%)
Gr64cNP_001246610.1 Trehalose_recp 1..407 CDD:253587 246/406 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131090210
eggNOG 1 0.900 E1_28M3V
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005347
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21421
RoundUp 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.