DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gr64d and Gr64f

Sequence 1:NP_001027105.2 Gene:Gr64d FlyBaseID:FBgn0035486 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_728924.2 Gene:Gr64f FlyBaseID:FBgn0052255 Length:469 Species:Drosophila melanogaster

Alignment Length:403 Identity:115/404 (28%)
Similarity:210/404 (52%) Gaps:30/404 (7%)


  Fly     2 ERSVQENTLHYTIGHVLIIARIFGVLPLAGINPNGK-PENVRFRWFSPYILFFVVAFTFVIADFM 65
            |..:.:.:.|..:|.||::|..|.::|:.|:  .|| |.::.|.|.:....|.::.....:|:|.
  Fly    69 EAFLSDGSFHQAVGRVLLVAEFFAMMPVKGV--TGKHPSDLSFSWRNIRTCFSLLFIASSLANFG 131

  Fly    66 LSTKIVLNDGLQLYTMGSLSF--SVICIFCFGSFIKLSRRWPHIIRETALCERIFLKPCYANQEG 128
            ||...|||:.:...::..:.|  ||:.:....  :.|:|:||.::......|:..  |.|..|  
  Fly   132 LSLFKVLNNPISFNSIKPIIFRGSVLLVLIVA--LNLARQWPQLMMYWHTVEKDL--PQYKTQ-- 190

  Fly   129 LNFTRFLRRW------ALILLVA---ALCEHLTYVGSAAWSNYVQIRDCNLKVGFVENYFLRERQ 184
                  |.:|      ::::|:.   :..||:..:.||.  ||...  ||.....::|||||...
  Fly   191 ------LTKWKMGHTISMVMLLGMMLSFAEHILSMVSAI--NYASF--CNRTADPIQNYFLRTND 245

  Fly   185 ELFSVFEYRAWMVFFIEWNTMAMTFVWNFGDIFLFLMCRGLKIRFQQLHWRIRQNLGKPMAKEFW 249
            |:|.|..|...:..:.::..:..||:||:.|:|:.::..||..:|:||:..:|...|..||..:|
  Fly   246 EIFFVTSYSTTLALWGKFQNVFSTFIWNYMDLFVMIVSIGLASKFRQLNDDLRNFKGMNMAPSYW 310

  Fly   250 QEIRSDFLDLDSLLKLYDKELSGLILVCCAHNMYFICVQVYHSFQVKGAFMDELYFWFCLLYVIS 314
            .|.|..:.::..|....|..:|.:.:|..::|:||||||:..|.....:....:||:|.|:::|.
  Fly   311 SERRIQYRNICILCDKMDDAISLITMVSFSNNLYFICVQLLRSLNTMPSVAHAVYFYFSLIFLIG 375

  Fly   315 RLMNMMLAASSIPQEIKDISNTLYEVRSSPWCDELGRLSEMLRNETFALSGMGYFYVTRRLIFAM 379
            |.:.:.|.:||:..|.:.....|..|....||.|:.|.:|.:.::..||:||.:|::||:|:.::
  Fly   376 RTLAVSLYSSSVHDESRLTLRYLRCVPKESWCPEVKRFTEEVISDEVALTGMKFFHLTRKLVLSV 440

  Fly   380 AGALMGYELVLFR 392
            ||.::.|||||.:
  Fly   441 AGTIVTYELVLIQ 453

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gr64dNP_001027105.2 Trehalose_recp 1..404 CDD:253587 115/404 (28%)
Gr64fNP_728924.2 Trehalose_recp 56..462 CDD:253587 115/404 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131090517
eggNOG 1 0.900 E1_28M3V
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005347
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21421
RoundUp 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.