powered by:
                   
 
    
    
             
          
            Protein Alignment CG33795 and CG33773
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_001027129.2 | Gene: | CG33795 / 3772625 | FlyBaseID: | FBgn0053795 | Length: | 178 | Species: | Drosophila melanogaster | 
          
            | Sequence 2: | NP_001027213.1 | Gene: | CG33773 / 3772436 | FlyBaseID: | FBgn0053773 | Length: | 179 | Species: | Drosophila melanogaster | 
        
        
        
          
            | Alignment Length: | 177 | Identity: | 48/177 - (27%) | 
          
            | Similarity: | 92/177 -  (51%) | Gaps: | 15/177 - (8%) | 
        
      
- Green bases have known domain annotations that are detailed below.
      | 
  Fly     3 NVLKIVVILVTFLLTWRLSYSVTYKLTNVICESRNQSWVTINECRLKAVNRNRTVFNFNATIHH- 66|::..::|..:.:.|     :..::.||:.|.:.:........|.||::||:....:....::.
 Fly     7 NLILAILIFYSIIKT-----NSRFEFTNLNCTAFDLRVGEFENCNLKSINRSYKYVSGKYKLNQI 66
 
 
  Fly    67 PTNDVVIDYRFLKRENGYKPWLYKKNIDGCRFLRKP-YDMLTKMIYMVFKPFSNINHTCPFYGDI 130|...:.:::...||.|||:|:||....|.|:|:..| .:.:.|.|:..|..:||:||:||:..|:
 Fly    67 PLPRMKVNFIMWKRLNGYRPFLYNITADACKFVENPKSNPVLKYIFDSFSAYSNMNHSCPYTSDL 131
 
 
  Fly   131 LIRG-----MYLR-TEIKAMPYPSGKYMLQINWSFYKKIQVVTNISY 171::..     |.|| |||  :|:|.|.|:.:.::|..|.|...|.:.:
 Fly   132 IVERLPIGFMNLRVTEI--LPFPEGNYLFEFHFSRRKSIFASTQVYF 176
 
 | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | Simple Score | Weighted Score | Original Tool Information | 
          
            | BLAST Result | Score | Score Type | Cluster ID | 
          
          
            | Compara | 1 | 0.930 | - | - |  | C45472450 | 
          
            | Domainoid | 0 | 0.000 | Not matched by this tool. | 
          
            | eggNOG | 0 | 0.000 | Not matched by this tool. | 
          
            | Homologene | 0 | 0.000 | Not matched by this tool. | 
          
            | Inparanoid | 0 | 0.000 | Not matched by this tool. | 
          
            | Isobase | 0 | 0.000 | Not matched by this tool. | 
          
            | OMA | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoDB | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoFinder | 1 | 1.000 | - | - |  | FOG0000262 | 
          
            | OrthoInspector | 0 | 0.000 | Not matched by this tool. | 
          
            | orthoMCL | 0 | 0.000 | Not matched by this tool. | 
          
            | Panther | 1 | 1.100 | - | - | P | PTHR20898 | 
          
            | Phylome | 1 | 0.910 | - | - |  |  | 
          
            | RoundUp | 0 | 0.000 | Not matched by this tool. | 
          
            | SonicParanoid | 1 | 1.000 | - | - |  | X90 | 
          
            |  | 5 | 4.940 |  | 
        
      
           
             Return to query results.
             Submit another query.