DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33795 and CG33773

DIOPT Version :8

Sequence 1:NP_001027129.2 Gene:CG33795 / 3772625 FlyBaseID:FBgn0053795 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027213.1 Gene:CG33773 / 3772436 FlyBaseID:FBgn0053773 Length:179 Species:Drosophila melanogaster

Alignment Length:177 Identity:48/178 (27%)
Similarity:92/178 (52%) Gaps:15/178 (8%)


  Fly     3 NVLKIVVILVTFLLTWRLSYSVTYKLTNVICESRNQSWVTINECRLKAVNRNRTVFNFNATIHH- 66
            |::..::|..:.:.|     :..::.||:.|.:.:........|.||::||:....:....::. 
  Fly     7 NLILAILIFYSIIKT-----NSRFEFTNLNCTAFDLRVGEFENCNLKSINRSYKYVSGKYKLNQI 66

  Fly    67 PTNDVVIDYRFLKRENGYKPWLYKKNIDGCRFLRKP-YDMLTKMIYMVFKPFSNINHTCPFYGDI 130
            |...:.:::...||.|||:|:||....|.|:|:..| .:.:.|.|:..|..:||:||:||:..|:
  Fly    67 PLPRMKVNFIMWKRLNGYRPFLYNITADACKFVENPKSNPVLKYIFDSFSAYSNMNHSCPYTSDL 131

  Fly   131 LIRG-----MYLR-TEIKAMPYPSGKYMLQINWSFYKKIQVVTNISY 171
            ::..     |.|| |||  :|:|.|.|:.:.::|..|.|...|.:.:
  Fly   132 IVERLPIGFMNLRVTEI--LPFPEGNYLFEFHFSRRKSIFASTQVYF 176

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33795NP_001027129.2 DUF1091 77..153 CDD:284008 32/83 (39%)
CG33773NP_001027213.1 DUF1091 73..158 CDD:284008 32/87 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C293679
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.